Endometriosis Knowledgebase

Search Result

Gene id

5295

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PIK3R1 Gene UCSC Ensembl

Aliases

AGM7, GRB1, IMD36, p85, p85-ALPHA

Gene name

phosphoinositide-3-kinase regulatory subunit 1

Alternate names

phosphatidylinositol 3-kinase regulatory subunit alpha, PI3-kinase subunit p85-alpha, PI3K regulatory subunit alpha, phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha, phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha), ph,

Gene location

5q13.1 (68215736: 68301820) Exons: 22 NC_000005.10

Gene summary(Entrez)

Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in four transcript variants encoding different isoforms. [provided by RefSeq, Jun 2011]

OMIM

171833

Protein Summary

Protein general information

P27986

Name: Phosphatidylinositol 3 kinase regulatory subunit alpha (PI3 kinase regulatory subunit alpha) (PI3K regulatory subunit alpha) (PtdIns 3 kinase regulatory subunit alpha) (Phosphatidylinositol 3 kinase 85 kDa regulatory subunit alpha) (PI3 kinase subunit p85

Length: 724 Mass: 83,598

Tissue specificity: Isoform 2 is expressed in skeletal muscle and brain, and at lower levels in kidney and cardiac muscle. Isoform 2 and isoform 4 are present in skeletal muscle (at protein level). {ECO

Sequence

MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVE
YIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLY
RTQSSSNLAELRQLLDCDTPSVDLEMIDVHVLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKK
LIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKG
GNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLH
EYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIM
HNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKT
ATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR

Structural information

Protein Domains	SH3. (3-79) Rho-GAP. (113-301) SH2 (333-428) SH2 (624-718)
Interpro:	IPR032498 IPR001720 IPR008936 IPR000198 IPR000980 IPR001452
Prosite:	PS50238 PS50001 PS50002
Pfam:	PF16454 PF00620 PF00017
PDB:	1A0N 1AZG 1H9O 1PBW 1PHT 1PIC 1PKS 1PKT 2IUG 2IUH 2IUI 2RD0 2V1Y 3HHM 3HIZ 3I5R 3I5S 4A55 4JPS 4L1B 4L23 4L2Y 4OVU 4OVV 4WAF 4YKN 4ZOP 5AUL 5FI4 5GJI 5ITD 5M6U 5SW8 5SWG 5SWO 5SWP 5SWR 5SWT 5SX8 5SX9 5SXA 5SXB 5SXC 5SXD 5SXE 5SXF 5SXI 5SXJ 5SXK 5UBT
PDBsum:	1A0N 1AZG 1H9O 1PBW 1PHT 1PIC 1PKS 1PKT 2IUG 2IUH 2IUI 2RD0 2V1Y 3HHM 3HIZ 3I5R 3I5S 4A55 4JPS 4L1B 4L23 4L2Y 4OVU 4OVV 4WAF 4YKN 4ZOP 5AUL 5FI4 5GJI 5ITD 5M6U 5SW8 5SWG 5SWO 5SWP 5SWR 5SWT 5SX8 5SX9 5SXA 5SXB 5SXC 5SXD 5SXE 5SXF 5SXI 5SXJ 5SXK 5UBT
DIP:	119
MINT:	93751
STRING:	ENSP00000274335;

Other Databases

GeneCards: PIK3R1; Malacards: PIK3R1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001678	cellular glucose homeosta sis	ISS	biological_process
GO:0001953	negative regulation of ce ll-matrix adhesion	IEA	biological_process
GO:0005068	transmembrane receptor pr otein tyrosine kinase ada ptor activity	ISS	molecular_function
GO:0005158	insulin receptor binding	IPI	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	IPI	molecular_function
GO:0005168	neurotrophin TRKA recepto r binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005801	cis-Golgi network	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005911	cell-cell junction	IEA	cellular_component
GO:0005942	phosphatidylinositol 3-ki nase complex	ISS	cellular_component
GO:0005942	phosphatidylinositol 3-ki nase complex	IBA	cellular_component
GO:0005943	phosphatidylinositol 3-ki nase complex, class IA	ISS	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006661	phosphatidylinositol bios ynthetic process	TAS	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	TAS	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008286	insulin receptor signalin g pathway	IBA	biological_process
GO:0008625	extrinsic apoptotic signa ling pathway via death do main receptors	IEA	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IEA	biological_process
GO:0014065	phosphatidylinositol 3-ki nase signaling	IDA	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0016303	1-phosphatidylinositol-3- kinase activity	TAS	molecular_function
GO:0019903	protein phosphatase bindi ng	IPI	molecular_function
GO:0030168	platelet activation	TAS	biological_process
GO:0030183	B cell differentiation	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0032869	cellular response to insu lin stimulus	ISS	biological_process
GO:0033120	positive regulation of RN A splicing	IMP	biological_process
GO:0034644	cellular response to UV	IEA	biological_process
GO:0034976	response to endoplasmic r eticulum stress	ISS	biological_process
GO:0034976	response to endoplasmic r eticulum stress	IDA	biological_process
GO:0035014	phosphatidylinositol 3-ki nase regulator activity	ISS	molecular_function
GO:0035014	phosphatidylinositol 3-ki nase regulator activity	ISS	molecular_function
GO:0036092	phosphatidylinositol-3-ph osphate biosynthetic proc ess	IEA	biological_process
GO:0036312	phosphatidylinositol 3-ki nase regulatory subunit b inding	IEA	molecular_function
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0042993	positive regulation of tr anscription factor import into nucleus	ISS	biological_process
GO:0042993	positive regulation of tr anscription factor import into nucleus	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043125	ErbB-3 class receptor bin ding	IDA	molecular_function
GO:0043548	phosphatidylinositol 3-ki nase binding	ISS	molecular_function
GO:0043551	regulation of phosphatidy linositol 3-kinase activi ty	ISS	biological_process
GO:0043551	regulation of phosphatidy linositol 3-kinase activi ty	IBA	biological_process
GO:0043559	insulin binding	IDA	molecular_function
GO:0043560	insulin receptor substrat e binding	ISS	molecular_function
GO:0045671	negative regulation of os teoclast differentiation	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0046326	positive regulation of gl ucose import	ISS	biological_process
GO:0046854	phosphatidylinositol phos phorylation	ISS	biological_process
GO:0046854	phosphatidylinositol phos phorylation	ISS	biological_process
GO:0046854	phosphatidylinositol phos phorylation	IBA	biological_process
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0046935	1-phosphatidylinositol-3- kinase regulator activity	IBA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048009	insulin-like growth facto r receptor signaling path way	IPI	biological_process
GO:0048009	insulin-like growth facto r receptor signaling path way	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051492	regulation of stress fibe r assembly	IEA	biological_process
GO:0051531	NFAT protein import into nucleus	IEA	biological_process
GO:0060396	growth hormone receptor s ignaling pathway	IDA	biological_process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	ISS	biological_process
GO:1900103	positive regulation of en doplasmic reticulum unfol ded protein response	IMP	biological_process
GO:1990578	perinuclear endoplasmic r eticulum membrane	IEA	cellular_component
GO:2001275	positive regulation of gl ucose import in response to insulin stimulus	ISS	biological_process
GO:2001275	positive regulation of gl ucose import in response to insulin stimulus	ISS	biological_process
GO:0001678	cellular glucose homeosta sis	IEA	biological_process
GO:0001678	cellular glucose homeosta sis	ISS	biological_process
GO:0001953	negative regulation of ce ll-matrix adhesion	IEA	biological_process
GO:0005068	transmembrane receptor pr otein tyrosine kinase ada ptor activity	ISS	molecular_function
GO:0005158	insulin receptor binding	IPI	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	IPI	molecular_function
GO:0005168	neurotrophin TRKA recepto r binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005801	cis-Golgi network	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005911	cell-cell junction	IEA	cellular_component
GO:0005942	phosphatidylinositol 3-ki nase complex	IEA	cellular_component
GO:0005942	phosphatidylinositol 3-ki nase complex	ISS	cellular_component
GO:0005942	phosphatidylinositol 3-ki nase complex	IBA	cellular_component
GO:0005943	phosphatidylinositol 3-ki nase complex, class IA	ISS	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006661	phosphatidylinositol bios ynthetic process	TAS	biological_process
GO:0006810	transport	IEA	biological_process
GO:0007162	negative regulation of ce ll adhesion	IEA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	TAS	biological_process
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008286	insulin receptor signalin g pathway	IBA	biological_process
GO:0008625	extrinsic apoptotic signa ling pathway via death do main receptors	IEA	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IEA	biological_process
GO:0014065	phosphatidylinositol 3-ki nase signaling	IDA	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0015031	protein transport	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0016303	1-phosphatidylinositol-3- kinase activity	TAS	molecular_function
GO:0019903	protein phosphatase bindi ng	IPI	molecular_function
GO:0030168	platelet activation	TAS	biological_process
GO:0030183	B cell differentiation	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0032869	cellular response to insu lin stimulus	IEA	biological_process
GO:0032869	cellular response to insu lin stimulus	ISS	biological_process
GO:0033120	positive regulation of RN A splicing	IMP	biological_process
GO:0034644	cellular response to UV	IEA	biological_process
GO:0034976	response to endoplasmic r eticulum stress	IEA	biological_process
GO:0034976	response to endoplasmic r eticulum stress	ISS	biological_process
GO:0034976	response to endoplasmic r eticulum stress	IDA	biological_process
GO:0035014	phosphatidylinositol 3-ki nase regulator activity	IEA	molecular_function
GO:0035014	phosphatidylinositol 3-ki nase regulator activity	ISS	molecular_function
GO:0035014	phosphatidylinositol 3-ki nase regulator activity	ISS	molecular_function
GO:0036092	phosphatidylinositol-3-ph osphate biosynthetic proc ess	IEA	biological_process
GO:0036312	phosphatidylinositol 3-ki nase regulatory subunit b inding	IEA	molecular_function
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0042993	positive regulation of tr anscription factor import into nucleus	IEA	biological_process
GO:0042993	positive regulation of tr anscription factor import into nucleus	ISS	biological_process
GO:0042993	positive regulation of tr anscription factor import into nucleus	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043125	ErbB-3 class receptor bin ding	IDA	molecular_function
GO:0043548	phosphatidylinositol 3-ki nase binding	ISS	molecular_function
GO:0043551	regulation of phosphatidy linositol 3-kinase activi ty	ISS	biological_process
GO:0043551	regulation of phosphatidy linositol 3-kinase activi ty	IBA	biological_process
GO:0043559	insulin binding	IDA	molecular_function
GO:0043560	insulin receptor substrat e binding	IEA	molecular_function
GO:0043560	insulin receptor substrat e binding	ISS	molecular_function
GO:0045671	negative regulation of os teoclast differentiation	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0046326	positive regulation of gl ucose import	ISS	biological_process
GO:0046854	phosphatidylinositol phos phorylation	ISS	biological_process
GO:0046854	phosphatidylinositol phos phorylation	ISS	biological_process
GO:0046854	phosphatidylinositol phos phorylation	IBA	biological_process
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0046935	1-phosphatidylinositol-3- kinase regulator activity	IBA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048009	insulin-like growth facto r receptor signaling path way	IPI	biological_process
GO:0048009	insulin-like growth facto r receptor signaling path way	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051492	regulation of stress fibe r assembly	IEA	biological_process
GO:0051531	NFAT protein import into nucleus	IEA	biological_process
GO:0060396	growth hormone receptor s ignaling pathway	IDA	biological_process
GO:0090003	regulation of establishme nt of protein localizatio n to plasma membrane	IEA	biological_process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	ISS	biological_process
GO:1900103	positive regulation of en doplasmic reticulum unfol ded protein response	IMP	biological_process
GO:1990578	perinuclear endoplasmic r eticulum membrane	IEA	cellular_component
GO:2001275	positive regulation of gl ucose import in response to insulin stimulus	ISS	biological_process
GO:2001275	positive regulation of gl ucose import in response to insulin stimulus	ISS	biological_process
GO:0001678	cellular glucose homeosta sis	ISS	biological_process
GO:0005068	transmembrane receptor pr otein tyrosine kinase ada ptor activity	ISS	molecular_function
GO:0005158	insulin receptor binding	IPI	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	IPI	molecular_function
GO:0005168	neurotrophin TRKA recepto r binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005942	phosphatidylinositol 3-ki nase complex	ISS	cellular_component
GO:0005942	phosphatidylinositol 3-ki nase complex	IBA	cellular_component
GO:0005943	phosphatidylinositol 3-ki nase complex, class IA	ISS	cellular_component
GO:0006661	phosphatidylinositol bios ynthetic process	TAS	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	TAS	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008286	insulin receptor signalin g pathway	IBA	biological_process
GO:0014065	phosphatidylinositol 3-ki nase signaling	IDA	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016303	1-phosphatidylinositol-3- kinase activity	TAS	molecular_function
GO:0019903	protein phosphatase bindi ng	IPI	molecular_function
GO:0030168	platelet activation	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0032869	cellular response to insu lin stimulus	ISS	biological_process
GO:0033120	positive regulation of RN A splicing	IMP	biological_process
GO:0034976	response to endoplasmic r eticulum stress	ISS	biological_process
GO:0034976	response to endoplasmic r eticulum stress	IDA	biological_process
GO:0035014	phosphatidylinositol 3-ki nase regulator activity	ISS	molecular_function
GO:0035014	phosphatidylinositol 3-ki nase regulator activity	ISS	molecular_function
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0042993	positive regulation of tr anscription factor import into nucleus	ISS	biological_process
GO:0042993	positive regulation of tr anscription factor import into nucleus	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043125	ErbB-3 class receptor bin ding	IDA	molecular_function
GO:0043548	phosphatidylinositol 3-ki nase binding	ISS	molecular_function
GO:0043551	regulation of phosphatidy linositol 3-kinase activi ty	ISS	biological_process
GO:0043551	regulation of phosphatidy linositol 3-kinase activi ty	IBA	biological_process
GO:0043559	insulin binding	IDA	molecular_function
GO:0043560	insulin receptor substrat e binding	ISS	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0046326	positive regulation of gl ucose import	ISS	biological_process
GO:0046854	phosphatidylinositol phos phorylation	ISS	biological_process
GO:0046854	phosphatidylinositol phos phorylation	ISS	biological_process
GO:0046854	phosphatidylinositol phos phorylation	IBA	biological_process
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0046935	1-phosphatidylinositol-3- kinase regulator activity	IBA	molecular_function
GO:0048009	insulin-like growth facto r receptor signaling path way	IPI	biological_process
GO:0048009	insulin-like growth facto r receptor signaling path way	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0060396	growth hormone receptor s ignaling pathway	IDA	biological_process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	ISS	biological_process
GO:1900103	positive regulation of en doplasmic reticulum unfol ded protein response	IMP	biological_process
GO:2001275	positive regulation of gl ucose import in response to insulin stimulus	ISS	biological_process
GO:2001275	positive regulation of gl ucose import in response to insulin stimulus	ISS	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05166  HTLV-I infection
hsa05205  Proteoglycans in cancer
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04510  Focal adhesion
hsa05169  Epstein-Barr virus infection
hsa05418  Fluid shear stress and atherosclerosis
hsa05161  Hepatitis B
hsa04062  Chemokine signaling pathway
hsa05224  Breast cancer
hsa05164  Influenza A
hsa04630  Jak-STAT signaling pathway
hsa04068  FoxO signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05203  Viral carcinogenesis
hsa04210  Apoptosis
hsa04668  TNF signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05142  Chagas disease
hsa05215  Prostate cancer
hsa01522  Endocrine resistance
hsa05162  Measles
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04380  Osteoclast differentiation
hsa04932  Non-alcoholic fatty liver disease
hsa04650  Natural killer cell mediated cytotoxicity
hsa04024  cAMP signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04066  HIF-1 signaling pathway
hsa05160  Hepatitis C
hsa04722  Neurotrophin signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04360  Axon guidance
hsa04620  Toll-like receptor signaling pathway
hsa05146  Amoebiasis
hsa04660  T cell receptor signaling pathway
hsa04915  Estrogen signaling pathway
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05212  Pancreatic cancer
hsa04152  AMPK signaling pathway
hsa01524  Platinum drug resistance
hsa05222  Small cell lung cancer
hsa04917  Prolactin signaling pathway
hsa05210  Colorectal cancer
hsa04012  ErbB signaling pathway
hsa04910  Insulin signaling pathway
hsa04150  mTOR signaling pathway
hsa04931  Insulin resistance
hsa04211  Longevity regulating pathway
hsa05230  Central carbon metabolism in cancer
hsa04670  Leukocyte transendothelial migration
hsa04071  Sphingolipid signaling pathway
hsa04140  Autophagy - animal
hsa05211  Renal cell carcinoma
hsa04914  Progesterone-mediated oocyte maturation
hsa04611  Platelet activation
hsa05231  Choline metabolism in cancer
hsa04213  Longevity regulating pathway
hsa05214  Glioma
hsa05213  Endometrial cancer
hsa05223  Non-small cell lung cancer
hsa04923  Regulation of lipolysis in adipocytes
hsa05221  Acute myeloid leukemia
hsa04370  VEGF signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa05100  Bacterial invasion of epithelial cells
hsa04725  Cholinergic synapse
hsa04662  B cell receptor signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04664  Fc epsilon RI signaling pathway
hsa04930  Type II diabetes mellitus
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04070  Phosphatidylinositol signaling system
hsa04973  Carbohydrate digestion and absorption

Diseases

Associated diseases	References
Agammaglobulinemias	OMIM: 171833
Alzheimer's disease	PMID: 12185156
Cancer	PMID: 19351817
Chronic kidney failure	PMID: 19578796
Diabetes	PMID: 14551916
Endometriosis	PMID: 16210010
Immunodeficiency	OMIM: 171833
Endometriosis	INFBASE16210010
Periodontitis	PMID: 15490304
Polycystic ovary syndrome (PCOS)	PMID: 18249389
SHORT syndrome	KEGG: H01370, OMIM: 171833

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16210010	Endometrio sis					RON SOS 14-3-3 protein eta KSR PI3K p85and uPAR	Show abstract