Endometriosis Knowledgebase

Search Result

Gene id

5321

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PLA2G4A Gene UCSC Ensembl

Aliases

PLA2G4, cPLA2, cPLA2-alpha

Gene name

phospholipase A2 group IVA

Alternate names

cytosolic phospholipase A2, calcium-dependent phospholipid-binding protein, lysophospholipase, phosphatidylcholine 2-acylhydrolase, phospholipase A2, group IVA (cytosolic, calcium-dependent),

Gene location

1q31.1 (186828899: 186989895) Exons: 19 NC_000001.11

Gene summary(Entrez)

This gene encodes a member of the cytosolic phospholipase A2 group IV family. The enzyme catalyzes the hydrolysis of membrane phospholipids to release arachidonic acid which is subsequently metabolized into eicosanoids. Eicosanoids, including prostaglandins and leukotrienes, are lipid-based cellular hormones that regulate hemodynamics, inflammatory responses, and other intracellular pathways. The hydrolysis reaction also produces lysophospholipids that are converted into platelet-activating factor. The enzyme is activated by increased intracellular Ca(2+) levels and phosphorylation, resulting in its translocation from the cytosol and nucleus to perinuclear membrane vesicles. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]

OMIM

600522

Protein Summary

Protein general information

P47712

Name: Cytosolic phospholipase A2 (cPLA2) (Phospholipase A2 group IVA) [Includes: Phospholipase A2 (EC 3.1.1.4) (Phosphatidylcholine 2 acylhydrolase); Lysophospholipase (EC 3.1.1.5)]

Length: 749 Mass: 85,239

Tissue specificity: Expressed in various tissues such as macrophages, platelets, neutrophils, fibroblasts and lung endothelium.

Sequence

MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRTRHFNNDINPVWNETF
EFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEVPFIFNQVTEMVLEMSLEVCSCPDLRFSMAL
CDQEKTFRQQRKEHIRESMKKLLGPKNSEGLHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVA
GLSGSTWYMSTLYSHPDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYGTFMAPDLFGSKFFMG
TVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGTENE
DAGSDYQSDNQASWIHRMIMALVSDSALFNTREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAV
ADPDEFERIYEPLDVKSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYRAPGVPRETEEEKEIADFDIFDDPE
SPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSKPKA

Structural information

Protein Domains	C2. (5-106) PLA2c. (140-740)
Interpro:	IPR016035 IPR000008 IPR002642
Prosite:	PS50004 PS51210
Pfam:	PF00168 PF01735
PDB:	1BCI 1CJY 1RLW
PDBsum:	1BCI 1CJY 1RLW
DIP:	40991
MINT:	118843
STRING:	ENSP00000356436;

Other Databases

GeneCards: PLA2G4A; Malacards: PLA2G4A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001542	ovulation from ovarian fo llicle	IEA	biological_process
GO:0001554	luteolysis	IEA	biological_process
GO:0004622	lysophospholipase activit y	TAS	molecular_function
GO:0004622	lysophospholipase activit y	TAS	molecular_function
GO:0004623	phospholipase A2 activity	NAS	molecular_function
GO:0004623	phospholipase A2 activity	IDA	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005544	calcium-dependent phospho lipid binding	IDA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005743	mitochondrial inner membr ane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005829	cytosol	NAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006644	phospholipid metabolic pr ocess	TAS	biological_process
GO:0006654	phosphatidic acid biosynt hetic process	TAS	biological_process
GO:0006663	platelet activating facto r biosynthetic process	NAS	biological_process
GO:0006690	icosanoid metabolic proce ss	NAS	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008970	phosphatidylcholine 1-acy lhydrolase activity	TAS	molecular_function
GO:0008970	phosphatidylcholine 1-acy lhydrolase activity	TAS	molecular_function
GO:0009395	phospholipid catabolic pr ocess	IEA	biological_process
GO:0009408	response to heat	IEA	biological_process
GO:0010226	response to lithium ion	IEA	biological_process
GO:0010243	response to organonitroge n compound	IEA	biological_process
GO:0019369	arachidonic acid metaboli c process	TAS	biological_process
GO:0030501	positive regulation of bo ne mineralization	IEA	biological_process
GO:0031340	positive regulation of ve sicle fusion	IEA	biological_process
GO:0031394	positive regulation of pr ostaglandin biosynthetic process	IEA	biological_process
GO:0031622	positive regulation of fe ver generation	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0033280	response to vitamin D	IEA	biological_process
GO:0035035	histone acetyltransferase binding	IEA	molecular_function
GO:0035965	cardiolipin acyl-chain re modeling	TAS	biological_process
GO:0036148	phosphatidylglycerol acyl -chain remodeling	TAS	biological_process
GO:0036149	phosphatidylinositol acyl -chain remodeling	TAS	biological_process
GO:0036150	phosphatidylserine acyl-c hain remodeling	TAS	biological_process
GO:0036151	phosphatidylcholine acyl- chain remodeling	TAS	biological_process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological_process
GO:0042542	response to hydrogen pero xide	IEA	biological_process
GO:0042588	zymogen granule	IEA	cellular_component
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043129	surfactant homeostasis	IEA	biological_process
GO:0046456	icosanoid biosynthetic pr ocess	IEA	biological_process
GO:0046697	decidualization	IEA	biological_process
GO:0047498	calcium-dependent phospho lipase A2 activity	EXP	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0050482	arachidonic acid secretio n	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051592	response to calcium ion	IEA	biological_process
GO:0051597	response to methylmercury	IEA	biological_process
GO:0071236	cellular response to anti biotic	IEA	biological_process
GO:0001542	ovulation from ovarian fo llicle	IEA	biological_process
GO:0001554	luteolysis	IEA	biological_process
GO:0004620	phospholipase activity	IEA	molecular_function
GO:0004622	lysophospholipase activit y	IEA	molecular_function
GO:0004622	lysophospholipase activit y	TAS	molecular_function
GO:0004622	lysophospholipase activit y	TAS	molecular_function
GO:0004623	phospholipase A2 activity	IEA	molecular_function
GO:0004623	phospholipase A2 activity	IEA	molecular_function
GO:0004623	phospholipase A2 activity	NAS	molecular_function
GO:0004623	phospholipase A2 activity	IDA	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005544	calcium-dependent phospho lipid binding	IDA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005743	mitochondrial inner membr ane	TAS	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	NAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006644	phospholipid metabolic pr ocess	TAS	biological_process
GO:0006654	phosphatidic acid biosynt hetic process	TAS	biological_process
GO:0006663	platelet activating facto r biosynthetic process	NAS	biological_process
GO:0006690	icosanoid metabolic proce ss	NAS	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008152	metabolic process	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008970	phosphatidylcholine 1-acy lhydrolase activity	TAS	molecular_function
GO:0008970	phosphatidylcholine 1-acy lhydrolase activity	TAS	molecular_function
GO:0009395	phospholipid catabolic pr ocess	IEA	biological_process
GO:0009408	response to heat	IEA	biological_process
GO:0009725	response to hormone	IEA	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010226	response to lithium ion	IEA	biological_process
GO:0010243	response to organonitroge n compound	IEA	biological_process
GO:0016042	lipid catabolic process	IEA	biological_process
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0019369	arachidonic acid metaboli c process	IEA	biological_process
GO:0019369	arachidonic acid metaboli c process	TAS	biological_process
GO:0030501	positive regulation of bo ne mineralization	IEA	biological_process
GO:0031340	positive regulation of ve sicle fusion	IEA	biological_process
GO:0031394	positive regulation of pr ostaglandin biosynthetic process	IEA	biological_process
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0031622	positive regulation of fe ver generation	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0033280	response to vitamin D	IEA	biological_process
GO:0035035	histone acetyltransferase binding	IEA	molecular_function
GO:0035965	cardiolipin acyl-chain re modeling	TAS	biological_process
GO:0036148	phosphatidylglycerol acyl -chain remodeling	TAS	biological_process
GO:0036149	phosphatidylinositol acyl -chain remodeling	TAS	biological_process
GO:0036150	phosphatidylserine acyl-c hain remodeling	TAS	biological_process
GO:0036151	phosphatidylcholine acyl- chain remodeling	TAS	biological_process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0042542	response to hydrogen pero xide	IEA	biological_process
GO:0042588	zymogen granule	IEA	cellular_component
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043129	surfactant homeostasis	IEA	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0046456	icosanoid biosynthetic pr ocess	IEA	biological_process
GO:0046697	decidualization	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0047498	calcium-dependent phospho lipase A2 activity	IEA	molecular_function
GO:0047498	calcium-dependent phospho lipase A2 activity	EXP	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0050482	arachidonic acid secretio n	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051592	response to calcium ion	IEA	biological_process
GO:0051597	response to methylmercury	IEA	biological_process
GO:0071236	cellular response to anti biotic	IEA	biological_process
GO:0004622	lysophospholipase activit y	TAS	molecular_function
GO:0004622	lysophospholipase activit y	TAS	molecular_function
GO:0004623	phospholipase A2 activity	NAS	molecular_function
GO:0004623	phospholipase A2 activity	IDA	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0004623	phospholipase A2 activity	TAS	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005544	calcium-dependent phospho lipid binding	IDA	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005743	mitochondrial inner membr ane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005829	cytosol	NAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006644	phospholipid metabolic pr ocess	TAS	biological_process
GO:0006654	phosphatidic acid biosynt hetic process	TAS	biological_process
GO:0006663	platelet activating facto r biosynthetic process	NAS	biological_process
GO:0006690	icosanoid metabolic proce ss	NAS	biological_process
GO:0008970	phosphatidylcholine 1-acy lhydrolase activity	TAS	molecular_function
GO:0008970	phosphatidylcholine 1-acy lhydrolase activity	TAS	molecular_function
GO:0019369	arachidonic acid metaboli c process	TAS	biological_process
GO:0035965	cardiolipin acyl-chain re modeling	TAS	biological_process
GO:0036148	phosphatidylglycerol acyl -chain remodeling	TAS	biological_process
GO:0036149	phosphatidylinositol acyl -chain remodeling	TAS	biological_process
GO:0036150	phosphatidylserine acyl-c hain remodeling	TAS	biological_process
GO:0036151	phosphatidylcholine acyl- chain remodeling	TAS	biological_process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological_process
GO:0047498	calcium-dependent phospho lipase A2 activity	EXP	molecular_function

KEGG pathways

hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04913  Ovarian steroidogenesis
hsa04611  Platelet activation
hsa05231  Choline metabolism in cancer
hsa04921  Oxytocin signaling pathway
hsa04912  GnRH signaling pathway
hsa04726  Serotonergic synapse
hsa04370  VEGF signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04666  Fc gamma R-mediated phagocytosis
hsa04664  Fc epsilon RI signaling pathway
hsa00590  Arachidonic acid metabolism
hsa04270  Vascular smooth muscle contraction
hsa04730  Long-term depression
hsa04724  Glutamatergic synapse
hsa00591  Linoleic acid metabolism
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00592  alpha-Linolenic acid metabolism

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Asthma	PMID: 19450127
Bipolar disorder	PMID: 15118355
Depression	PMID: 20034614
Diabetes	PMID: 12765847
Endometriosis	PMID: 25446850
Endometriosis	INFBASE25446850
Osteoarthritis	PMID: 18471798
Phospholipase A2 deficiency	OMIM: 600522
Schizophrenia	PMID: 16181776

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25446850	Endometrio sis			57 (29 patients with ovarian endometriosis, 28 control heal thy women)	Female infertility	PGF2A AKR1B1 AKR1C3 PLA2G2A PTGS2/COX-2 ABCC4 and PTGFR PLA2G4A and HPGD	Show abstract