Endometriosis Knowledgebase

Search Result

Gene id

5328

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PLAU Gene UCSC Ensembl

Aliases

ATF, BDPLT5, QPD, UPA, URK, u-PA

Gene name

plasminogen activator, urokinase

Alternate names

urokinase-type plasminogen activator, U-plasminogen activator, plasminogen activator, urinary,

Gene location

10q22.2 (73909181: 73917500) Exons: 12 NC_000010.11

Gene summary(Entrez)

This gene encodes a secreted serine protease that converts plasminogen to plasmin. The encoded preproprotein is proteolytically processed to generate A and B polypeptide chains. These chains associate via a single disulfide bond to form the catalytically inactive high molecular weight urokinase-type plasminogen activator (HMW-uPA). HMW-uPA can be further processed into the catalytically active low molecular weight urokinase-type plasminogen activator (LMW-uPA). This low molecular weight form does not bind to the urokinase-type plasminogen activator receptor. Mutations in this gene may be associated with Quebec platelet disorder and late-onset Alzheimer's disease. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]

OMIM

191840

SNPs

rs2227564

Strand:    Allele origin: T(germline)/C(germline)  Allele change: C/T   Mutation type: snp

CM000672.2   g.73913343T>C
NC_000010.10   g.75673101T=
NC_000010.10   g.75673101T>C
NC_000010.11   g.73913343T=
NC_000010.11   g.73913343T>C
NG_011904.1   g.7240C=
NG_011904.1   g.7240C>T
NM_001001791.2   c.-73-268A>G
NM_001001791.2   c.-73-268G>A
NM_001145031.1   c.371C=
NM_001145031.1   c.371C>T
NM_001145031.2   c.371C=
NM_001145031.2   c.371C>T
NM_001319191.1   c.164C=
NM_001319191.1   c.164C>T
NM_002658.3   c.422C=
NM_002658.3   c.422C>T
NM_002658.4   c.422C=
NM_002658.4   c.422C>T
NP_001138503.1   p.Pro124=
NP_001138503.1   p.Pro124Leu
NP_001306120.1   p.Pro55=
NP_001306120.1   p.Pro55Leu
NP_002649.1   p.Pro141=
NP_002649.1   p.Pro141Leu
XP_005269958.1   p.Leu55=
XP_005269958.1   p.Leu55Pro
XP_011538168.1   p.Leu141=
XP_011538168.1   p.Leu141Pro
Clinical Significance: other

rs2227579

Strand:    Allele origin:   Allele change: A/C/T   Mutation type: snp

CM000672.2   g.73911531C>A
CM000672.2   g.73911531C>T
NC_000010.10   g.75671289C>T
NC_000010.11   g.73911531C>A
NC_000010.11   g.73911531C>T
NG_011904.1   g.5428C>A
NG_011904.1   g.5428C>T
NM_001001791.2   c.*154G>A
NM_001001791.2   c.*154G>T
NM_001145031.1   c.-361C>A
NM_001145031.1   c.-361C>T
NM_001145031.2   c.-361C>A
NM_001145031.2   c.-361C>T
NM_001319191.1   c.-255C>A
NM_001319191.1   c.-255C>T
NM_002658.3   c.-25C>A
NM_002658.3   c.-25C>T
NM_002658.4   c.-25C>A
NM_002658.4   c.-25C>T
Clinical Significance: Likely benign

Protein Summary

Protein general information

P00749

Name: Urokinase type plasminogen activator (U plasminogen activator) (uPA) (EC 3.4.21.73) [Cleaved into: Urokinase type plasminogen activator long chain A; Urokinase type plasminogen activator short chain A; Urokinase type plasminogen activator chain B]

Length: 431 Mass: 48,507

Tissue specificity: Expressed in the prostate gland and prostate cancers. {ECO

Sequence

MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNG
HFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHD
CADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHC
FIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGD
SGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

Structural information

Protein Domains	EGF-like. (27-63) Kringle. (70-151) Peptidase (179-424)
Interpro:	IPR013032 IPR000742 IPR000001 IPR013806 IPR018056 IPR009003 IPR001314 IPR001254 IPR018114 IPR033116
Prosite:	PS00022 PS50026 PS00021 PS50070 PS50240 PS00134 PS00135
Pfam:	PF00051 PF00089
CDD:	cd00190
PDB:	1C5W 1C5X 1C5Y 1C5Z 1EJN 1F5K 1F5L 1F92 1FV9 1GI7 1GI8 1GI9 1GJ7 1GJ8 1GJ9 1GJA 1GJB 1GJC 1GJD 1KDU 1LMW 1O3P 1O5A 1O5B 1O5C 1OWD 1OWE 1OWH 1OWI 1OWJ 1OWK 1SC8 1SQA 1SQO 1SQT 1U6Q 1URK 1VJ9 1VJA 1W0Z 1W10 1W11 1W12 1W13 1W14 2FD6 2I9A 2I9B 2NWN 2O8T 2O8U
PDBsum:	1C5W 1C5X 1C5Y 1C5Z 1EJN 1F5K 1F5L 1F92 1FV9 1GI7 1GI8 1GI9 1GJ7 1GJ8 1GJ9 1GJA 1GJB 1GJC 1GJD 1KDU 1LMW 1O3P 1O5A 1O5B 1O5C 1OWD 1OWE 1OWH 1OWI 1OWJ 1OWK 1SC8 1SQA 1SQO 1SQT 1U6Q 1URK 1VJ9 1VJA 1W0Z 1W10 1W11 1W12 1W13 1W14 2FD6 2I9A 2I9B 2NWN 2O8T 2O8U
DIP:	46387
STRING:	ENSP00000361850;

Other Databases

GeneCards: PLAU; Malacards: PLAU

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEA	biological_process
GO:0004252	serine-type endopeptidase activity	IBA	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007283	spermatogenesis	IEA	biological_process
GO:0007566	embryo implantation	IEA	biological_process
GO:0007596	blood coagulation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0010469	regulation of receptor ac tivity	IDA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0014909	smooth muscle cell migrat ion	IEA	biological_process
GO:0014910	regulation of smooth musc le cell migration	IDA	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0033628	regulation of cell adhesi on mediated by integrin	IDA	biological_process
GO:0035729	cellular response to hepa tocyte growth factor stim ulus	IEA	biological_process
GO:0042730	fibrinolysis	TAS	biological_process
GO:0043403	skeletal muscle tissue re generation	IEA	biological_process
GO:0055093	response to hyperoxia	IEA	biological_process
GO:0060279	positive regulation of ov ulation	IEA	biological_process
GO:0061041	regulation of wound heali ng	IC	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070997	neuron death	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0071498	cellular response to flui d shear stress	IEA	biological_process
GO:0072734	cellular response to stau rosporine	IEA	biological_process
GO:2000097	regulation of smooth musc le cell-matrix adhesion	IDA	biological_process
GO:2000345	regulation of hepatocyte proliferation	IEA	biological_process
GO:2000379	positive regulation of re active oxygen species met abolic process	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0004252	serine-type endopeptidase activity	IEA	molecular_function
GO:0004252	serine-type endopeptidase activity	IBA	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	TAS	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007283	spermatogenesis	IEA	biological_process
GO:0007566	embryo implantation	IEA	biological_process
GO:0007596	blood coagulation	IEA	biological_process
GO:0007599	hemostasis	IEA	biological_process
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008236	serine-type peptidase act ivity	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0010469	regulation of receptor ac tivity	IDA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0014909	smooth muscle cell migrat ion	IEA	biological_process
GO:0014910	regulation of smooth musc le cell migration	IDA	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0033628	regulation of cell adhesi on mediated by integrin	IDA	biological_process
GO:0035728	response to hepatocyte gr owth factor	IEA	biological_process
GO:0035729	cellular response to hepa tocyte growth factor stim ulus	IEA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0042730	fibrinolysis	IEA	biological_process
GO:0042730	fibrinolysis	IEA	biological_process
GO:0042730	fibrinolysis	TAS	biological_process
GO:0043403	skeletal muscle tissue re generation	IEA	biological_process
GO:0055093	response to hyperoxia	IEA	biological_process
GO:0060279	positive regulation of ov ulation	IEA	biological_process
GO:0061041	regulation of wound heali ng	IC	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070997	neuron death	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071310	cellular response to orga nic substance	IEA	biological_process
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0071498	cellular response to flui d shear stress	IEA	biological_process
GO:0072734	cellular response to stau rosporine	IEA	biological_process
GO:2000097	regulation of smooth musc le cell-matrix adhesion	IDA	biological_process
GO:2000345	regulation of hepatocyte proliferation	IEA	biological_process
GO:2000379	positive regulation of re active oxygen species met abolic process	IEA	biological_process
GO:0004252	serine-type endopeptidase activity	IBA	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006508	proteolysis	TAS	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0010469	regulation of receptor ac tivity	IDA	biological_process
GO:0014910	regulation of smooth musc le cell migration	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0033628	regulation of cell adhesi on mediated by integrin	IDA	biological_process
GO:0042730	fibrinolysis	TAS	biological_process
GO:0061041	regulation of wound heali ng	IC	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:2000097	regulation of smooth musc le cell-matrix adhesion	IDA	biological_process

KEGG pathways

hsa05206  MicroRNAs in cancer
hsa05205  Proteoglycans in cancer
hsa05202  Transcriptional misregulation in cancer
hsa04064  NF-kappa B signaling pathway
hsa04610  Complement and coagulation cascades

Diseases

Associated diseases	References
Alzheimer's disease	OMIM: 191840
Asthma	PMID: 17363771
Azoospermia	PMID: 1908531
Bronchopulmonary dysplasia	PMID: 15868845
Cancer	PMID: 19526059
Chronic prostatitis	PMID: 15362519
Diabetes	PMID: 15750768
Endometriosis	PMID: 9806560
Endometriosis	PMID: 16274610
Nephrolithiasis	PMID: 16509805
Endometriosis	INFBASE9806560
Oligoasthenoteratozoospermia	PMID: 1908531
Oligoasthenozoospermia	PMID: 17009528
Osteoporosis	PMID: 15927351
Implantation failure	PMID: 16274610
Quebec platelet disorder	OMIM: 191840
Rheumatoid arthritis	PMID: 15083890
Spermatogenetic defects	PMID: 9812782
Urolithiasis	PMID: 11880102

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
19945964	Endometrio sis		VEGF-A uPA MMP-3 thrombospondin-1 PAI-1 TIMP-1	Show abstract
15579491	Endometrio sis	89 (57 women wi th endometriosi s, 32 controls)		Show abstract
14981142	Endometrio sis		uPA PAI-1 uPAR	Show abstract
12832381	Endometrio sis	74 (39 women wi th endometriosi s, 35 controls)	uPA PAI-1 MMP-3 TIMP-1	Show abstract
14644829	Endometrio sis		uPA IGFBP-3	Show abstract
17506371	Endometrio sis		TGF-beta1 uPA	Show abstract
9806560	Endometrio sis		u-PA PAI-1 PAI-2	Show abstract