Endometriosis Knowledgebase

Search Result

Gene id

5329

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PLAUR Gene UCSC Ensembl

Aliases

CD87, U-PAR, UPAR, URKR

Gene name

plasminogen activator, urokinase receptor

Alternate names

urokinase plasminogen activator surface receptor, monocyte activation antigen Mo3, u-plasminogen activator receptor form 2, urokinase-type plasminogen activator (uPA) receptor,

Gene location

19q13.31 (43670345: 43646094) Exons: 11 NC_000019.10

Gene summary(Entrez)

This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. [provided by RefSeq, Jul 2008]

OMIM

173391

Protein Summary

Protein general information

Q03405

Name: Urokinase plasminogen activator surface receptor (U PAR) (uPAR) (Monocyte activation antigen Mo3) (CD antigen CD87)

Length: 335 Mass: 36,978

Tissue specificity: Expressed in neurons of the rolandic area of the brain (at protein level). Expressed in the brain.

Sequence

MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNR
TLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTH
WIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTH
GCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT

Structural information

Protein Domains	UPAR/Ly6 (23-114) UPAR/Ly6 (115-213) UPAR/Ly6 (214-305)
Interpro:	IPR018363 IPR016054 IPR033084
Prosite:	PS00983
Pfam:	PF00021
PDB:	1YWH 2FD6 2I9B 3BT1 3BT2 3U73 3U74 4K24 4QTI
PDBsum:	1YWH 2FD6 2I9B 3BT1 3BT2 3U73 3U74 4K24 4QTI
DIP:	137
MINT:	1370900
STRING:	ENSP00000339328;

Other Databases

GeneCards: PLAUR; Malacards: PLAUR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0004872	receptor activity	NAS	molecular_function
GO:0004872	receptor activity	NAS	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IEA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006928	movement of cell or subce llular component	NAS	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007596	blood coagulation	NAS	biological_process
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0016255	attachment of GPI anchor to protein	TAS	biological_process
GO:0019898	extrinsic component of me mbrane	TAS	cellular_component
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019904	protein domain specific b inding	IPI	molecular_function
GO:0030162	regulation of proteolysis	NAS	biological_process
GO:0030377	urokinase plasminogen act ivator receptor activity	IBA	molecular_function
GO:0030377	urokinase plasminogen act ivator receptor activity	NAS	molecular_function
GO:0030377	urokinase plasminogen act ivator receptor activity	NAS	molecular_function
GO:0031225	anchored component of mem brane	IEA	cellular_component
GO:0038195	urokinase plasminogen act ivator signaling pathway	IBA	biological_process
GO:0042730	fibrinolysis	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043388	positive regulation of DN A binding	IDA	biological_process
GO:0045742	positive regulation of ep idermal growth factor rec eptor signaling pathway	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071438	invadopodium membrane	IEA	cellular_component
GO:0090200	positive regulation of re lease of cytochrome c fro m mitochondria	IMP	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IMP	biological_process
GO:2001268	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic signaling pathway	IMP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0004872	receptor activity	TAS	molecular_function
GO:0004872	receptor activity	NAS	molecular_function
GO:0004872	receptor activity	NAS	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IEA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006928	movement of cell or subce llular component	NAS	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0007596	blood coagulation	NAS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0016255	attachment of GPI anchor to protein	TAS	biological_process
GO:0019898	extrinsic component of me mbrane	TAS	cellular_component
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019904	protein domain specific b inding	IPI	molecular_function
GO:0030054	cell junction	IEA	cellular_component
GO:0030162	regulation of proteolysis	IEA	biological_process
GO:0030162	regulation of proteolysis	NAS	biological_process
GO:0030377	urokinase plasminogen act ivator receptor activity	IEA	molecular_function
GO:0030377	urokinase plasminogen act ivator receptor activity	IBA	molecular_function
GO:0030377	urokinase plasminogen act ivator receptor activity	NAS	molecular_function
GO:0030377	urokinase plasminogen act ivator receptor activity	NAS	molecular_function
GO:0031225	anchored component of mem brane	IEA	cellular_component
GO:0038195	urokinase plasminogen act ivator signaling pathway	IEA	biological_process
GO:0038195	urokinase plasminogen act ivator signaling pathway	IBA	biological_process
GO:0042730	fibrinolysis	TAS	biological_process
GO:0042995	cell projection	IEA	cellular_component
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043388	positive regulation of DN A binding	IDA	biological_process
GO:0045742	positive regulation of ep idermal growth factor rec eptor signaling pathway	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071438	invadopodium membrane	IEA	cellular_component
GO:0090200	positive regulation of re lease of cytochrome c fro m mitochondria	IMP	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IMP	biological_process
GO:2001268	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic signaling pathway	IMP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0004872	receptor activity	TAS	molecular_function
GO:0004872	receptor activity	NAS	molecular_function
GO:0004872	receptor activity	NAS	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006928	movement of cell or subce llular component	NAS	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0007596	blood coagulation	NAS	biological_process
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0016255	attachment of GPI anchor to protein	TAS	biological_process
GO:0019898	extrinsic component of me mbrane	TAS	cellular_component
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019904	protein domain specific b inding	IPI	molecular_function
GO:0030162	regulation of proteolysis	NAS	biological_process
GO:0030377	urokinase plasminogen act ivator receptor activity	IBA	molecular_function
GO:0030377	urokinase plasminogen act ivator receptor activity	NAS	molecular_function
GO:0030377	urokinase plasminogen act ivator receptor activity	NAS	molecular_function
GO:0038195	urokinase plasminogen act ivator signaling pathway	IBA	biological_process
GO:0042730	fibrinolysis	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043388	positive regulation of DN A binding	IDA	biological_process
GO:0045742	positive regulation of ep idermal growth factor rec eptor signaling pathway	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0090200	positive regulation of re lease of cytochrome c fro m mitochondria	IMP	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IMP	biological_process
GO:2001268	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic signaling pathway	IMP	biological_process

KEGG pathways

hsa05205 Proteoglycans in cancer
hsa04610 Complement and coagulation cascades

Diseases

Associated diseases	References
Asthma	PMID: 19878584
Cancer	PMID: 19117638
Endometriosis	PMID: 16210010
Endometriosis	INFBASE9464855
Oligoasthenozoospermia	PMID: 17009528

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
17609243	Endometrio sis	121 (71 women w ith endometrios is, 50 controls )	VEGF uPA and MMP-3	Show abstract
9464855	Endometrio sis	26 (10 patients with endometri osis, 16 women without endomet riosis)	suPA-R	Show abstract
14981142	Endometrio sis		uPA PAI-1 uPAR	Show abstract
16210010	Endometrio sis		RON SOS 14-3-3 protein eta KSR PI3K p85and uPAR	Show abstract