Endometriosis Knowledgebase

Search Result

Gene id

5347

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PLK1 Gene UCSC Ensembl

Aliases

PLK, STPK13

Gene name

polo like kinase 1

Alternate names

serine/threonine-protein kinase PLK1, PLK-1, cell cycle regulated protein kinase, polo (Drosophia)-like kinase, serine/threonine-protein kinase 13,

Gene location

16p12.2 (23678771: 23690366) Exons: 10 NC_000016.10

Gene summary(Entrez)

The Ser/Thr protein kinase encoded by this gene belongs to the CDC5/Polo subfamily. It is highly expressed during mitosis and elevated levels are found in many different types of cancer. Depletion of this protein in cancer cells dramatically inhibited cell proliferation and induced apoptosis; hence, it is a target for cancer therapy. [provided by RefSeq, Sep 2015]

OMIM

602098

Protein Summary

Protein general information

P53350

Name: Serine/threonine protein kinase PLK1 (EC 2.7.11.21) (Polo like kinase 1) (PLK 1) (Serine/threonine protein kinase 13) (STPK13)

Length: 603 Mass: 68,255

Tissue specificity: Placenta and colon.

Sequence

MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADT
KEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTE
PEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSK
KGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELL
NDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLS
DMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDS
LQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHL
SNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRL
KAS

Structural information

Protein Domains	Protein (53-305) POLO (417-480) POLO (515-584)
Motifs	D-box that(337-340)
Interpro:	IPR011009 IPR033702 IPR033701 IPR033695 IPR000959 IPR000719 IPR017441 IPR008271
Prosite:	PS50078 PS00107 PS50011 PS00108
Pfam:	PF00069 PF00659
CDD:	cd13118 cd13117 cd14187
PDB:	1Q4K 1Q4O 1UMW 2OGQ 2OJX 2OU7 2OWB 2RKU 2V5Q 2YAC 3BZI 3C5L 3FC2 3FVH 3HIH 3HIK 3KB7 3P2W 3P2Z 3P34 3P35 3P36 3P37 3Q1I 3RQ7 3THB 4A4L 4A4O 4DFW 4E67 4E9C 4E9D 4H5X 4H71 4HAB 4HCO 4HY2 4J52 4J53 4LKL 4LKM 4O56 4O6W 4O9W 4RCP 4WHH 4WHK 4WHL 4X9R 4X9V 4X9W
PDBsum:	1Q4K 1Q4O 1UMW 2OGQ 2OJX 2OU7 2OWB 2RKU 2V5Q 2YAC 3BZI 3C5L 3FC2 3FVH 3HIH 3HIK 3KB7 3P2W 3P2Z 3P34 3P35 3P36 3P37 3Q1I 3RQ7 3THB 4A4L 4A4O 4DFW 4E67 4E9C 4E9D 4H5X 4H71 4HAB 4HCO 4HY2 4J52 4J53 4LKL 4LKM 4O56 4O6W 4O9W 4RCP 4WHH 4WHK 4WHL 4X9R 4X9V 4X9W
DIP:	29696
MINT:	86316
STRING:	ENSP00000300093;

Other Databases

GeneCards: PLK1; Malacards: PLK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000070	mitotic sister chromatid segregation	IMP	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	IDA	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	TAS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000281	mitotic cytokinesis	IDA	biological_process
GO:0000776	kinetochore	IDA	cellular_component
GO:0000776	kinetochore	IDA	cellular_component
GO:0000776	kinetochore	IDA	cellular_component
GO:0000776	kinetochore	IDA	cellular_component
GO:0000776	kinetochore	IDA	cellular_component
GO:0000785	chromatin	IEA	cellular_component
GO:0000795	synaptonemal complex	IEA	cellular_component
GO:0000910	cytokinesis	IMP	biological_process
GO:0000910	cytokinesis	IDA	biological_process
GO:0000922	spindle pole	IDA	cellular_component
GO:0000922	spindle pole	IDA	cellular_component
GO:0000942	condensed nuclear chromos ome outer kinetochore	IDA	cellular_component
GO:0001578	microtubule bundle format ion	IDA	biological_process
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005819	spindle	IDA	cellular_component
GO:0005819	spindle	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0007062	sister chromatid cohesion	TAS	biological_process
GO:0007062	sister chromatid cohesion	TAS	biological_process
GO:0007067	mitotic nuclear division	IMP	biological_process
GO:0007067	mitotic nuclear division	IDA	biological_process
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological_process
GO:0007094	mitotic spindle assembly checkpoint	IMP	biological_process
GO:0007346	regulation of mitotic cel l cycle	IMP	biological_process
GO:0008017	microtubule binding	IDA	molecular_function
GO:0008283	cell proliferation	TAS	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IMP	biological_process
GO:0010997	anaphase-promoting comple x binding	IPI	molecular_function
GO:0015630	microtubule cytoskeleton	IDA	cellular_component
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016321	female meiosis chromosome segregation	IEA	biological_process
GO:0016567	protein ubiquitination	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030071	regulation of mitotic met aphase/anaphase transitio n	IMP	biological_process
GO:0030496	midbody	IDA	cellular_component
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological_process
GO:0031572	G2 DNA damage checkpoint	IDA	biological_process
GO:0031648	protein destabilization	IDA	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IMP	biological_process
GO:0042787	protein ubiquitination in volved in ubiquitin-depen dent protein catabolic pr ocess	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043393	regulation of protein bin ding	IMP	biological_process
GO:0045143	homologous chromosome seg regation	IEA	biological_process
GO:0045184	establishment of protein localization	IMP	biological_process
GO:0045736	negative regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IMP	biological_process
GO:0045862	positive regulation of pr oteolysis	IDA	biological_process
GO:0051233	spindle midzone	IDA	cellular_component
GO:0051233	spindle midzone	IDA	cellular_component
GO:0051297	centrosome organization	IMP	biological_process
GO:0051297	centrosome organization	IMP	biological_process
GO:0051437	positive regulation of ub iquitin-protein ligase ac tivity involved in regula tion of mitotic cell cycl e transition	TAS	biological_process
GO:0051439	regulation of ubiquitin-p rotein ligase activity in volved in mitotic cell cy cle	TAS	biological_process
GO:0051443	positive regulation of ub iquitin-protein transfera se activity	IMP	biological_process
GO:0051726	regulation of cell cycle	TAS	biological_process
GO:0051726	regulation of cell cycle	TAS	biological_process
GO:0051726	regulation of cell cycle	TAS	biological_process
GO:0051726	regulation of cell cycle	TAS	biological_process
GO:0070194	synaptonemal complex disa ssembly	IEA	biological_process
GO:0071168	protein localization to c hromatin	IDA	biological_process
GO:1900182	positive regulation of pr otein localization to nuc leus	TAS	biological_process
GO:1901673	regulation of mitotic spi ndle assembly	IDA	biological_process
GO:1902749	regulation of cell cycle G2/M phase transition	TAS	biological_process
GO:1904668	positive regulation of ub iquitin protein ligase ac tivity	IDA	biological_process
GO:0005876	spindle microtubule	IDA	cellular_component
GO:0000070	mitotic sister chromatid segregation	IMP	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	IDA	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	TAS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0000281	mitotic cytokinesis	IDA	biological_process
GO:0000775	chromosome, centromeric r egion	IEA	cellular_component
GO:0000776	kinetochore	IEA	cellular_component
GO:0000776	kinetochore	IEA	cellular_component
GO:0000776	kinetochore	IDA	cellular_component
GO:0000776	kinetochore	IDA	cellular_component
GO:0000776	kinetochore	IDA	cellular_component
GO:0000776	kinetochore	IDA	cellular_component
GO:0000776	kinetochore	IDA	cellular_component
GO:0000777	condensed chromosome kine tochore	IEA	cellular_component
GO:0000780	condensed nuclear chromos ome, centromeric region	IEA	cellular_component
GO:0000785	chromatin	IEA	cellular_component
GO:0000795	synaptonemal complex	IEA	cellular_component
GO:0000910	cytokinesis	IMP	biological_process
GO:0000910	cytokinesis	IDA	biological_process
GO:0000922	spindle pole	IDA	cellular_component
GO:0000922	spindle pole	IDA	cellular_component
GO:0000942	condensed nuclear chromos ome outer kinetochore	IDA	cellular_component
GO:0001578	microtubule bundle format ion	IDA	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	NAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005694	chromosome	IEA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005815	microtubule organizing ce nter	IEA	cellular_component
GO:0005819	spindle	IEA	cellular_component
GO:0005819	spindle	IDA	cellular_component
GO:0005819	spindle	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0007062	sister chromatid cohesion	TAS	biological_process
GO:0007062	sister chromatid cohesion	TAS	biological_process
GO:0007067	mitotic nuclear division	IEA	biological_process
GO:0007067	mitotic nuclear division	IMP	biological_process
GO:0007067	mitotic nuclear division	IDA	biological_process
GO:0007067	mitotic nuclear division	TAS	biological_process
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological_process
GO:0007094	mitotic spindle assembly checkpoint	IMP	biological_process
GO:0007346	regulation of mitotic cel l cycle	IMP	biological_process
GO:0008017	microtubule binding	IDA	molecular_function
GO:0008283	cell proliferation	TAS	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IMP	biological_process
GO:0010997	anaphase-promoting comple x binding	IPI	molecular_function
GO:0015630	microtubule cytoskeleton	IDA	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016321	female meiosis chromosome segregation	IEA	biological_process
GO:0016567	protein ubiquitination	IDA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030071	regulation of mitotic met aphase/anaphase transitio n	IMP	biological_process
GO:0030496	midbody	IEA	cellular_component
GO:0030496	midbody	IDA	cellular_component
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological_process
GO:0031572	G2 DNA damage checkpoint	IDA	biological_process
GO:0031648	protein destabilization	IDA	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IMP	biological_process
GO:0042787	protein ubiquitination in volved in ubiquitin-depen dent protein catabolic pr ocess	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043393	regulation of protein bin ding	IMP	biological_process
GO:0045143	homologous chromosome seg regation	IEA	biological_process
GO:0045184	establishment of protein localization	IMP	biological_process
GO:0045736	negative regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IMP	biological_process
GO:0045862	positive regulation of pr oteolysis	IDA	biological_process
GO:0051233	spindle midzone	IDA	cellular_component
GO:0051233	spindle midzone	IDA	cellular_component
GO:0051297	centrosome organization	IMP	biological_process
GO:0051297	centrosome organization	IMP	biological_process
GO:0051301	cell division	IEA	biological_process
GO:0051437	positive regulation of ub iquitin-protein ligase ac tivity involved in regula tion of mitotic cell cycl e transition	TAS	biological_process
GO:0051439	regulation of ubiquitin-p rotein ligase activity in volved in mitotic cell cy cle	TAS	biological_process
GO:0051443	positive regulation of ub iquitin-protein transfera se activity	IMP	biological_process
GO:0051726	regulation of cell cycle	TAS	biological_process
GO:0051726	regulation of cell cycle	TAS	biological_process
GO:0051726	regulation of cell cycle	TAS	biological_process
GO:0051726	regulation of cell cycle	TAS	biological_process
GO:0070194	synaptonemal complex disa ssembly	IEA	biological_process
GO:0071168	protein localization to c hromatin	IDA	biological_process
GO:1900182	positive regulation of pr otein localization to nuc leus	TAS	biological_process
GO:1901673	regulation of mitotic spi ndle assembly	IDA	biological_process
GO:1902749	regulation of cell cycle G2/M phase transition	TAS	biological_process
GO:1904668	positive regulation of ub iquitin protein ligase ac tivity	IDA	biological_process
GO:0005876	spindle microtubule	IDA	cellular_component
GO:0000070	mitotic sister chromatid segregation	IMP	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	IDA	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	TAS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000281	mitotic cytokinesis	IDA	biological_process
GO:0000776	kinetochore	IDA	cellular_component
GO:0000776	kinetochore	IDA	cellular_component
GO:0000776	kinetochore	IDA	cellular_component
GO:0000776	kinetochore	IDA	cellular_component
GO:0000776	kinetochore	IDA	cellular_component
GO:0000910	cytokinesis	IMP	biological_process
GO:0000910	cytokinesis	IDA	biological_process
GO:0000922	spindle pole	IDA	cellular_component
GO:0000922	spindle pole	IDA	cellular_component
GO:0000942	condensed nuclear chromos ome outer kinetochore	IDA	cellular_component
GO:0001578	microtubule bundle format ion	IDA	biological_process
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	NAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005819	spindle	IDA	cellular_component
GO:0005819	spindle	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0007062	sister chromatid cohesion	TAS	biological_process
GO:0007062	sister chromatid cohesion	TAS	biological_process
GO:0007067	mitotic nuclear division	IMP	biological_process
GO:0007067	mitotic nuclear division	IDA	biological_process
GO:0007067	mitotic nuclear division	TAS	biological_process
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological_process
GO:0007094	mitotic spindle assembly checkpoint	IMP	biological_process
GO:0007346	regulation of mitotic cel l cycle	IMP	biological_process
GO:0008017	microtubule binding	IDA	molecular_function
GO:0008283	cell proliferation	TAS	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IMP	biological_process
GO:0010997	anaphase-promoting comple x binding	IPI	molecular_function
GO:0015630	microtubule cytoskeleton	IDA	cellular_component
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016567	protein ubiquitination	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030071	regulation of mitotic met aphase/anaphase transitio n	IMP	biological_process
GO:0030496	midbody	IDA	cellular_component
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological_process
GO:0031572	G2 DNA damage checkpoint	IDA	biological_process
GO:0031648	protein destabilization	IDA	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IMP	biological_process
GO:0042787	protein ubiquitination in volved in ubiquitin-depen dent protein catabolic pr ocess	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043393	regulation of protein bin ding	IMP	biological_process
GO:0045184	establishment of protein localization	IMP	biological_process
GO:0045736	negative regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IMP	biological_process
GO:0045862	positive regulation of pr oteolysis	IDA	biological_process
GO:0051233	spindle midzone	IDA	cellular_component
GO:0051233	spindle midzone	IDA	cellular_component
GO:0051297	centrosome organization	IMP	biological_process
GO:0051297	centrosome organization	IMP	biological_process
GO:0051437	positive regulation of ub iquitin-protein ligase ac tivity involved in regula tion of mitotic cell cycl e transition	TAS	biological_process
GO:0051439	regulation of ubiquitin-p rotein ligase activity in volved in mitotic cell cy cle	TAS	biological_process
GO:0051443	positive regulation of ub iquitin-protein transfera se activity	IMP	biological_process
GO:0051726	regulation of cell cycle	TAS	biological_process
GO:0051726	regulation of cell cycle	TAS	biological_process
GO:0051726	regulation of cell cycle	TAS	biological_process
GO:0051726	regulation of cell cycle	TAS	biological_process
GO:0071168	protein localization to c hromatin	IDA	biological_process
GO:1900182	positive regulation of pr otein localization to nuc leus	TAS	biological_process
GO:1901673	regulation of mitotic spi ndle assembly	IDA	biological_process
GO:1902749	regulation of cell cycle G2/M phase transition	TAS	biological_process
GO:1904668	positive regulation of ub iquitin protein ligase ac tivity	IDA	biological_process
GO:0005876	spindle microtubule	IDA	cellular_component

KEGG pathways

hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04914  Progesterone-mediated oocyte maturation
hsa04114  Oocyte meiosis

Diseases

Associated diseases	References
Cancer	PMID: 19692168
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Endometriosis	PMID: 18353325
Endometriosis	INFBASE18353325

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
18353325	Endometrio sis				Female infertility	cyclin B1 cdc2 and Plk1	Show abstract