Endometriosis Knowledgebase

Search Result

Gene id

53616

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ADAM22 Gene UCSC Ensembl

Aliases

ADAM 22, MDC2

Gene name

ADAM metallopeptidase domain 22

Alternate names

disintegrin and metalloproteinase domain-containing protein 22, a disintegrin and metalloproteinase domain 22, metalloproteinase-disintegrin ADAM22-3, metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2,

Gene location

7q21.12 (87934142: 88202888) Exons: 36 NC_000007.14

Gene summary(Entrez)

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. Unlike other members of the ADAM protein family, the protein encoded by this gene lacks metalloprotease activity since it has no zinc-binding motif. This gene is highly expressed in the brain and may function as an integrin ligand in the brain. In mice, it has been shown to be essential for correct myelination in the peripheral nervous system. Alternative splicing results in several transcript variants.[provided by RefSeq, Dec 2010]

OMIM

603709

Protein Summary

Protein general information

Q9P0K1

Name: Disintegrin and metalloproteinase domain containing protein 22 (ADAM 22) (Metalloproteinase disintegrin ADAM22 3) (Metalloproteinase like, disintegrin like, and cysteine rich protein 2)

Length: 906 Mass: 100,433

Tissue specificity: Highly expressed in the brain and in some high-grade but not low-grade gliomas. Detected slightly or not at all in other tissues. {ECO

Sequence

MQAAVAVSVPFLLLCVLGTCPPARCGQAGDASLMELEKRKENRFVERQSIVPLRLIYRSGGEDESRHDALDTRVR
GDLGGPQLTHVDQASFQVDAFGTSFILDVVLNHDLLSSEYIERHIEHGGKTVEVKGGEHCYYQGHIRGNPDSFVA
LSTCHGLHGMFYDGNHTYLIEPEENDTTQEDFHFHSVYKSRLFEFSLDDLPSEFQQVNITPSKFILKPRPKRSKR
QLRRYPRNVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWATDNKFA
ISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEFGKTDLMAVTLAQSLA
HNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNIEEYHDFLNSGGGACLFNKPSKLLDPPECGNG
FIETGEECDCGTPAECVLEGAECCKKCTLTQDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAP
NIHKMDGYSCDGVQGICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLC
GYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVEDGTPCGPQMMCLEHRCLPVASFN
FSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCNTYFPHNDDAKTGITLSGNGVAGTNIIIGIIAGTILVLA
LILGITAWGYKNYREQRQLPQGDYVKKPGDGDSFYSDIPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDIC
ENGRPRSNSWQGNLGGNKKKIRGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSAR
LWETSI

Structural information

Protein Domains	Peptidase (239-438) Disintegrin. (444-531) EGF-like. (675-712)
Interpro:	IPR006586 IPR018358 IPR001762 IPR013032 IPR013111 IPR024079 IPR001590 IPR002870 IPR034027
Prosite:	PS50215 PS00427 PS50214 PS00022
Pfam:	PF08516 PF00200 PF07974 PF01562 PF01421
CDD:	cd04269
PDB:	3G5C
PDBsum:	3G5C
MINT:	252818
STRING:	ENSP00000265727;

Other Databases

GeneCards: ADAM22; Malacards: ADAM22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0005178	integrin binding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007162	negative regulation of ce ll adhesion	NAS	biological_process
GO:0007417	central nervous system de velopment	TAS	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0008344	adult locomotory behavior	IEA	biological_process
GO:0016021	integral component of mem brane	ISS	cellular_component
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0022011	myelination in peripheral nervous system	IEA	biological_process
GO:0030424	axon	ISS	cellular_component
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0005178	integrin binding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007162	negative regulation of ce ll adhesion	NAS	biological_process
GO:0007417	central nervous system de velopment	TAS	biological_process
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0008344	adult locomotory behavior	IEA	biological_process
GO:0014037	Schwann cell differentiat ion	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	ISS	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0022011	myelination in peripheral nervous system	IEA	biological_process
GO:0030424	axon	IEA	cellular_component
GO:0030424	axon	ISS	cellular_component
GO:0030424	axon	IEA	cellular_component
GO:0042063	gliogenesis	IEA	biological_process
GO:0042995	cell projection	IEA	cellular_component
GO:0005178	integrin binding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007162	negative regulation of ce ll adhesion	NAS	biological_process
GO:0007417	central nervous system de velopment	TAS	biological_process
GO:0016021	integral component of mem brane	ISS	cellular_component
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0030424	axon	ISS	cellular_component

Diseases

Associated diseases	References
Endometriosis (ovarian)	PMID: 25298284
Ovarian endometriosis	PMID: 25298284
Ovarian endometriosis	PMID: 25298284
Schizophrenia	PMID: 19054571
Ovarian endometriosis	INFBASE25298284

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25298284	Endometrio sis (ovari an)			50 (30 EMS-asso ciated ovarian carcinoma (18 O varian endometr ioid cancer, 12 ovarian clear cell cancer), 2 0 normal endome trial specimens )		RASSF2 RUNX3 GSTZ1 CYP2A GBGT1 NDUFS1 SPOCK2 ADAM22 and TRIM36	Show abstract