Endometriosis Knowledgebase

Search Result

Gene id

53833

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL20RB Gene UCSC Ensembl

Aliases

DIRS1, FNDC6, IL-20R2

Gene name

interleukin 20 receptor subunit beta

Alternate names

interleukin-20 receptor subunit beta, IL-20 receptor subunit beta, IL-20R-beta, IL-20RB, fibronectin type III domain containing 6, interleukin 20 receptor beta subunit, interleukin-20 receptor II,

Gene location

3q22.3 (136957864: 137011084) Exons: 9 NC_000003.12

Gene summary(Entrez)

IL20RB and IL20RA (MIM 605620) form a heterodimeric receptor for interleukin-20 (IL20; MIM 605619) (Blumberg et al., 2001 [PubMed 11163236]).[supplied by OMIM, Feb 2009]

OMIM

605621

Protein Summary

Protein general information

Q6UXL0

Name: Interleukin-20 receptor subunit beta (IL-20 receptor subunit beta) (IL-20R-beta) (IL-20RB) (Fibronectin type III domain containing 6) (FNDC6) (IL-20R2)

Length: 311 Mass: 35,076

Tissue specificity: Widely expressed with highest levels in skin and testis. Highly expressed in psoriatic skin. {ECO

Sequence

MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYE
SLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGF
HLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVE
VQGEAIPLVLALFAFVGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVM
SPEELLRAWIS

Structural information

Protein Domains	Fibronectin (37-136) Fibronectin (144-228)
Interpro:	IPR003961 IPR036116 IPR013783 IPR015373
Prosite:	PS50853
Pfam:	PF09294 PF01108
CDD:	cd00063
PDB:	4DOH
PDBsum:	4DOH
STRING:	ENSP00000328133;

Other Databases

GeneCards: IL20RB; Malacards: IL20RB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001808	negative regulation of ty pe IV hypersensitivity	IEA	biological_process
GO:0002437	inflammatory response to antigenic stimulus	IEA	biological_process
GO:0002765	immune response-inhibitin g signal transduction	IEA	biological_process
GO:0004896	cytokine receptor activit y	IBA	molecular_function
GO:0005886	plasma membrane	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0016021	integral component of mem brane	IBA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	IEA	biological_process
GO:0032703	negative regulation of in terleukin-2 production	IEA	biological_process
GO:0032733	positive regulation of in terleukin-10 production	IEA	biological_process
GO:0032753	positive regulation of in terleukin-4 production	IEA	biological_process
GO:0042015	interleukin-20 binding	IEA	molecular_function
GO:0042130	negative regulation of T cell proliferation	IEA	biological_process
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological_process
GO:0001808	negative regulation of ty pe IV hypersensitivity	IEA	biological_process
GO:0002437	inflammatory response to antigenic stimulus	IEA	biological_process
GO:0002765	immune response-inhibitin g signal transduction	IEA	biological_process
GO:0004896	cytokine receptor activit y	IBA	molecular_function
GO:0005886	plasma membrane	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IBA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	IEA	biological_process
GO:0032703	negative regulation of in terleukin-2 production	IEA	biological_process
GO:0032733	positive regulation of in terleukin-10 production	IEA	biological_process
GO:0032753	positive regulation of in terleukin-4 production	IEA	biological_process
GO:0042015	interleukin-20 binding	IEA	molecular_function
GO:0042130	negative regulation of T cell proliferation	IEA	biological_process
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological_process
GO:0050863	regulation of T cell acti vation	IEA	biological_process
GO:0004896	cytokine receptor activit y	IBA	molecular_function
GO:0005886	plasma membrane	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0016021	integral component of mem brane	IBA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process

KEGG pathways

hsa04630 Jak-STAT signaling pathway
hsa04060 Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Endometriosis	INFBASE27624484

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
27624484	Endometrio sis						Show abstract