Endometriosis Knowledgebase

Search Result

Gene id

54106

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TLR9 Gene UCSC Ensembl

Aliases

CD289

Gene name

toll like receptor 9

Alternate names

toll-like receptor 9,

Gene location

3p21.2 (52226162: 52221079) Exons: 2 NC_000003.12

Gene summary(Entrez)

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylated CpG dinucleotides in bacterial DNA to mount an innate immune response. [provided by RefSeq, Jul 2008]

OMIM

605474

Protein Summary

Protein general information

Q9NR96

Name: Toll like receptor 9 (CD antigen CD289)

Length: 1032 Mass: 115,860

Tissue specificity: Highly expressed in spleen, lymph node, tonsil and peripheral blood leukocytes, especially in plasmacytoid pre-dendritic cells. Levels are much lower in monocytes and CD11c+ immature dendritic cells. Also detected in lung and liver.

Sequence

MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAAPRGNVTSLSLSSNRI
HHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSL
SHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYL
LLSYNRIVKLAPEDLANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSFGSLVALKELDMHGIF
FRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYVDLSDNRISGASELTATMGEADGGEKVWLQP
GDLAPAPVDTPSSEDFRPNCSTLNFTLDLSRNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQV
LDLSHNKLDLYHEHSFTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRLRDNYLAFFKWWSLHF
LPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGFFSKAKELRELNLSANALKTVDHSWFGPLAS
ALQILDVSANPLHCACGAAFMDFLLEVQAAVPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLA
VALGLGVPMLHHLCGWDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLEDRKDVVVLVILSPDG
RRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHFYNRNFCQGPTAE

Structural information

Protein Domains	TIR. (868-1016)
Interpro:	IPR032675 IPR001611 IPR003591 IPR000157 IPR027181
Prosite:	PS51450 PS50104
Pfam:	PF13516 PF13855 PF01582
DIP:	52371
STRING:	ENSP00000417517;

Other Databases

GeneCards: TLR9; Malacards: TLR9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0002224	toll-like receptor signal ing pathway	TAS	biological_process
GO:0002224	toll-like receptor signal ing pathway	TAS	biological_process
GO:0002237	response to molecule of b acterial origin	TAS	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	IEA	biological_process
GO:0004888	transmembrane signaling r eceptor activity	IEA	molecular_function
GO:0005149	interleukin-1 receptor bi nding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005764	lysosome	ISS	cellular_component
GO:0005768	endosome	ISS	cellular_component
GO:0005783	endoplasmic reticulum	ISS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0007252	I-kappaB phosphorylation	IDA	biological_process
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016303	1-phosphatidylinositol-3- kinase activity	TAS	molecular_function
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0016324	apical plasma membrane	IDA	cellular_component
GO:0030277	maintenance of gastrointe stinal epithelium	ISS	biological_process
GO:0032009	early phagosome	ISS	cellular_component
GO:0032088	negative regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0032640	tumor necrosis factor pro duction	IDA	biological_process
GO:0032715	negative regulation of in terleukin-6 production	ISS	biological_process
GO:0032717	negative regulation of in terleukin-8 production	IDA	biological_process
GO:0032722	positive regulation of ch emokine production	IDA	biological_process
GO:0032725	positive regulation of gr anulocyte macrophage colo ny-stimulating factor pro duction	IDA	biological_process
GO:0032728	positive regulation of in terferon-beta production	ISS	biological_process
GO:0032733	positive regulation of in terleukin-10 production	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	ISS	biological_process
GO:0032741	positive regulation of in terleukin-18 production	ISS	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0034122	negative regulation of to ll-like receptor signalin g pathway	IDA	biological_process
GO:0034123	positive regulation of to ll-like receptor signalin g pathway	IDA	biological_process
GO:0034162	toll-like receptor 9 sign aling pathway	TAS	biological_process
GO:0035197	siRNA binding	IMP	molecular_function
GO:0036020	endolysosome membrane	TAS	cellular_component
GO:0036020	endolysosome membrane	TAS	cellular_component
GO:0036020	endolysosome membrane	TAS	cellular_component
GO:0036092	phosphatidylinositol-3-ph osphate biosynthetic proc ess	IEA	biological_process
GO:0042346	positive regulation of NF -kappaB import into nucle us	IDA	biological_process
GO:0042742	defense response to bacte rium	NAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043507	positive regulation of JU N kinase activity	IDA	biological_process
GO:0045078	positive regulation of in terferon-gamma biosynthet ic process	IDA	biological_process
GO:0045087	innate immune response	TAS	biological_process
GO:0045356	positive regulation of in terferon-alpha biosynthet ic process	IDA	biological_process
GO:0045359	positive regulation of in terferon-beta biosyntheti c process	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0046330	positive regulation of JN K cascade	IC	biological_process
GO:0050707	regulation of cytokine se cretion	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IC	biological_process
GO:0050829	defense response to Gram- negative bacterium	IMP	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	ISS	biological_process
GO:1901895	negative regulation of ca lcium-transporting ATPase activity	IDA	biological_process
GO:0007409	axonogenesis	IBA	biological_process
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0002224	toll-like receptor signal ing pathway	TAS	biological_process
GO:0002224	toll-like receptor signal ing pathway	TAS	biological_process
GO:0002237	response to molecule of b acterial origin	IEA	biological_process
GO:0002237	response to molecule of b acterial origin	TAS	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	IEA	biological_process
GO:0004888	transmembrane signaling r eceptor activity	IEA	molecular_function
GO:0005149	interleukin-1 receptor bi nding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005764	lysosome	ISS	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005768	endosome	ISS	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005783	endoplasmic reticulum	ISS	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007252	I-kappaB phosphorylation	IDA	biological_process
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016303	1-phosphatidylinositol-3- kinase activity	TAS	molecular_function
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0016324	apical plasma membrane	IDA	cellular_component
GO:0030277	maintenance of gastrointe stinal epithelium	ISS	biological_process
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0032009	early phagosome	ISS	cellular_component
GO:0032088	negative regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0032640	tumor necrosis factor pro duction	IDA	biological_process
GO:0032715	negative regulation of in terleukin-6 production	ISS	biological_process
GO:0032717	negative regulation of in terleukin-8 production	IDA	biological_process
GO:0032722	positive regulation of ch emokine production	IDA	biological_process
GO:0032725	positive regulation of gr anulocyte macrophage colo ny-stimulating factor pro duction	IDA	biological_process
GO:0032728	positive regulation of in terferon-beta production	ISS	biological_process
GO:0032733	positive regulation of in terleukin-10 production	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	ISS	biological_process
GO:0032741	positive regulation of in terleukin-18 production	ISS	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0034122	negative regulation of to ll-like receptor signalin g pathway	IDA	biological_process
GO:0034123	positive regulation of to ll-like receptor signalin g pathway	IDA	biological_process
GO:0034162	toll-like receptor 9 sign aling pathway	IEA	biological_process
GO:0034162	toll-like receptor 9 sign aling pathway	TAS	biological_process
GO:0035197	siRNA binding	IMP	molecular_function
GO:0036020	endolysosome membrane	TAS	cellular_component
GO:0036020	endolysosome membrane	TAS	cellular_component
GO:0036020	endolysosome membrane	TAS	cellular_component
GO:0036092	phosphatidylinositol-3-ph osphate biosynthetic proc ess	IEA	biological_process
GO:0042346	positive regulation of NF -kappaB import into nucle us	IDA	biological_process
GO:0042742	defense response to bacte rium	NAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043507	positive regulation of JU N kinase activity	IDA	biological_process
GO:0045078	positive regulation of in terferon-gamma biosynthet ic process	IDA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045087	innate immune response	TAS	biological_process
GO:0045335	phagocytic vesicle	IEA	cellular_component
GO:0045356	positive regulation of in terferon-alpha biosynthet ic process	IDA	biological_process
GO:0045359	positive regulation of in terferon-beta biosyntheti c process	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0046330	positive regulation of JN K cascade	IC	biological_process
GO:0050707	regulation of cytokine se cretion	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IC	biological_process
GO:0050829	defense response to Gram- negative bacterium	IMP	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	ISS	biological_process
GO:1901895	negative regulation of ca lcium-transporting ATPase activity	IDA	biological_process
GO:0007409	axonogenesis	IBA	biological_process
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0002224	toll-like receptor signal ing pathway	TAS	biological_process
GO:0002224	toll-like receptor signal ing pathway	TAS	biological_process
GO:0002237	response to molecule of b acterial origin	TAS	biological_process
GO:0005149	interleukin-1 receptor bi nding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005764	lysosome	ISS	cellular_component
GO:0005768	endosome	ISS	cellular_component
GO:0005783	endoplasmic reticulum	ISS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0007252	I-kappaB phosphorylation	IDA	biological_process
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0016303	1-phosphatidylinositol-3- kinase activity	TAS	molecular_function
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0016324	apical plasma membrane	IDA	cellular_component
GO:0030277	maintenance of gastrointe stinal epithelium	ISS	biological_process
GO:0032009	early phagosome	ISS	cellular_component
GO:0032088	negative regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0032640	tumor necrosis factor pro duction	IDA	biological_process
GO:0032715	negative regulation of in terleukin-6 production	ISS	biological_process
GO:0032717	negative regulation of in terleukin-8 production	IDA	biological_process
GO:0032722	positive regulation of ch emokine production	IDA	biological_process
GO:0032725	positive regulation of gr anulocyte macrophage colo ny-stimulating factor pro duction	IDA	biological_process
GO:0032728	positive regulation of in terferon-beta production	ISS	biological_process
GO:0032733	positive regulation of in terleukin-10 production	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	ISS	biological_process
GO:0032741	positive regulation of in terleukin-18 production	ISS	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0034122	negative regulation of to ll-like receptor signalin g pathway	IDA	biological_process
GO:0034123	positive regulation of to ll-like receptor signalin g pathway	IDA	biological_process
GO:0034162	toll-like receptor 9 sign aling pathway	TAS	biological_process
GO:0035197	siRNA binding	IMP	molecular_function
GO:0036020	endolysosome membrane	TAS	cellular_component
GO:0036020	endolysosome membrane	TAS	cellular_component
GO:0036020	endolysosome membrane	TAS	cellular_component
GO:0042346	positive regulation of NF -kappaB import into nucle us	IDA	biological_process
GO:0042742	defense response to bacte rium	NAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043507	positive regulation of JU N kinase activity	IDA	biological_process
GO:0045078	positive regulation of in terferon-gamma biosynthet ic process	IDA	biological_process
GO:0045087	innate immune response	TAS	biological_process
GO:0045356	positive regulation of in terferon-alpha biosynthet ic process	IDA	biological_process
GO:0045359	positive regulation of in terferon-beta biosyntheti c process	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0046330	positive regulation of JN K cascade	IC	biological_process
GO:0050729	positive regulation of in flammatory response	IC	biological_process
GO:0050829	defense response to Gram- negative bacterium	IMP	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	ISS	biological_process
GO:1901895	negative regulation of ca lcium-transporting ATPase activity	IDA	biological_process
GO:0007409	axonogenesis	IBA	biological_process

KEGG pathways

hsa05152  Tuberculosis
hsa05168  Herpes simplex infection
hsa05142  Chagas disease
hsa05162  Measles
hsa04620  Toll-like receptor signaling pathway
hsa05144  Malaria
hsa05143  African trypanosomiasis

Diseases

Associated diseases	References
Asthma	PMID: 14987294
Atherosclerosis	PMID: 16125159
Atopic dermatitis	KEGG: H01358
Atopy	PMID: 16164440
Behcet's disease	PMID: 17854429
Cancer	PMID: 16971956
Dermatitis	PMID: 17573724
Endometriosis	PMID: 23935397
Endometriosis	INFBASE23935397
Multiple sclerosis	PMID: 18208876
Myocardial infarction	PMID: 12573264
Polycystic ovary syndrome (PCOS)	PMID: 27367829
Primary biliary cirrhosis	PMID: 15878652
Sarcoidosis	PMID: 16608528
Systemic lupus erythematosus	PMID: 15730519

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23935397	Endometrio sis			80 (40 patients with endometri osis, 40 withou t endometriosis )		TLR-2 TLR -9 NOD-1 NOD-2 and NOS	Show abstract