Endometriosis Knowledgebase

Search Result

Gene id

54206

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ERRFI1 Gene UCSC Ensembl

Aliases

GENE-33, MIG-6, MIG6, RALT

Gene name

ERBB receptor feedback inhibitor 1

Alternate names

ERBB receptor feedback inhibitor 1, mitogen-inducible gene 6 protein, receptor-associated late transducer,

Gene location

1p36.23 (8026332: 8011718) Exons: 5 NC_000001.11

Gene summary(Entrez)

ERRFI1 is a cytoplasmic protein whose expression is upregulated with cell growth (Wick et al., 1995 [PubMed 7641805]). It shares significant homology with the protein product of rat gene-33, which is induced during cell stress and mediates cell signaling (Makkinje et al., 2000 [PubMed 10749885]; Fiorentino et al., 2000 [PubMed 11003669]).[supplied by OMIM, Mar 2008]

OMIM

608069

Protein Summary

Protein general information

Q9UJM3

Name: ERBB receptor feedback inhibitor 1 (Mitogen inducible gene 6 protein) (MIG 6)

Length: 462 Mass: 50,560

Sequence

MSIAGVAAQEIRVPLKTGFLHNGRAMGNMRKTYWSSRSEFKNNFLNIDPITMAYSLNSSAQERLIPLGHASKSAP
MNGHCFAENGPSQKSSLPPLLIPPSENLGPHEEDQVVCGFKKLTVNGVCASTPPLTPIKNSPSLFPCAPLCERGS
RPLPPLPISEALSLDDTDCEVEFLTSSDTDFLLEDSTLSDFKYDVPGRRSFRGCGQINYAYFDTPAVSAADLSYV
SDQNGGVPDPNPPPPQTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDKPEVPPRVPIPPRPVKPDYRR
WSAEVTSSTYSDEDRPPKVPPREPLSPSNSRTPSPKSLPSYLNGVMPPTQSFAPDPKYVSSKALQRQNSEGSASK
VPCILPIIENGKKVSSTHYYLLPERPPYLDKYEKFFREAEETNGGAQIQPLPADCGISSATEKPDSKTKMDLGGH
VKRKHLSYVVSP

Structural information

Interpro:	IPR021619
Pfam:	PF11555
PDB:	2RF9 2RFD 2RFE 4I21 4R3P 4R3R 4ZJV
PDBsum:	2RF9 2RFD 2RFE 4I21 4R3P 4R3R 4ZJV
DIP:	42379
MINT:	1591605
STRING:	ENSP00000366702;

Other Databases

GeneCards: ERRFI1; Malacards: ERRFI1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005096	GTPase activator activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006950	response to stress	TAS	biological_process
GO:0007175	negative regulation of ep idermal growth factor-act ivated receptor activity	ISS	biological_process
GO:0007175	negative regulation of ep idermal growth factor-act ivated receptor activity	IDA	biological_process
GO:0017124	SH3 domain binding	IEA	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	ISS	cellular_component
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IBA	cellular_component
GO:0031267	small GTPase binding	IEA	molecular_function
GO:0031953	negative regulation of pr otein autophosphorylation	IDA	biological_process
GO:0032691	negative regulation of in terleukin-1 beta producti on	IEA	biological_process
GO:0032869	cellular response to insu lin stimulus	IEA	biological_process
GO:0032966	negative regulation of co llagen biosynthetic proce ss	IEA	biological_process
GO:0036120	cellular response to plat elet-derived growth facto r stimulus	IEA	biological_process
GO:0042536	negative regulation of tu mor necrosis factor biosy nthetic process	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0043589	skin morphogenesis	ISS	biological_process
GO:0045616	regulation of keratinocyt e differentiation	ISS	biological_process
GO:0045616	regulation of keratinocyt e differentiation	IBA	biological_process
GO:0048286	lung alveolus development	ISS	biological_process
GO:0060426	lung vasculature developm ent	ISS	biological_process
GO:0060428	lung epithelium developme nt	ISS	biological_process
GO:0061469	regulation of type B panc reatic cell proliferation	IEA	biological_process
GO:0070373	negative regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0071364	cellular response to epid ermal growth factor stimu lus	IEA	biological_process
GO:0071474	cellular hyperosmotic res ponse	IEA	biological_process
GO:0071549	cellular response to dexa methasone stimulus	IEA	biological_process
GO:1903243	negative regulation of ca rdiac muscle hypertrophy in response to stress	IEA	biological_process
GO:0005096	GTPase activator activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006950	response to stress	TAS	biological_process
GO:0007175	negative regulation of ep idermal growth factor-act ivated receptor activity	IEA	biological_process
GO:0007175	negative regulation of ep idermal growth factor-act ivated receptor activity	ISS	biological_process
GO:0007175	negative regulation of ep idermal growth factor-act ivated receptor activity	IDA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0017124	SH3 domain binding	IEA	molecular_function
GO:0019900	kinase binding	IEA	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IEA	cellular_component
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	ISS	cellular_component
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IBA	cellular_component
GO:0031267	small GTPase binding	IEA	molecular_function
GO:0031953	negative regulation of pr otein autophosphorylation	IDA	biological_process
GO:0032691	negative regulation of in terleukin-1 beta producti on	IEA	biological_process
GO:0032869	cellular response to insu lin stimulus	IEA	biological_process
GO:0032966	negative regulation of co llagen biosynthetic proce ss	IEA	biological_process
GO:0036120	cellular response to plat elet-derived growth facto r stimulus	IEA	biological_process
GO:0042059	negative regulation of ep idermal growth factor rec eptor signaling pathway	IEA	biological_process
GO:0042536	negative regulation of tu mor necrosis factor biosy nthetic process	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0043589	skin morphogenesis	IEA	biological_process
GO:0043589	skin morphogenesis	ISS	biological_process
GO:0045616	regulation of keratinocyt e differentiation	IEA	biological_process
GO:0045616	regulation of keratinocyt e differentiation	ISS	biological_process
GO:0045616	regulation of keratinocyt e differentiation	IBA	biological_process
GO:0048286	lung alveolus development	IEA	biological_process
GO:0048286	lung alveolus development	ISS	biological_process
GO:0050732	negative regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0060426	lung vasculature developm ent	IEA	biological_process
GO:0060426	lung vasculature developm ent	ISS	biological_process
GO:0060428	lung epithelium developme nt	IEA	biological_process
GO:0060428	lung epithelium developme nt	ISS	biological_process
GO:0061469	regulation of type B panc reatic cell proliferation	IEA	biological_process
GO:0070373	negative regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0071364	cellular response to epid ermal growth factor stimu lus	IEA	biological_process
GO:0071474	cellular hyperosmotic res ponse	IEA	biological_process
GO:0071549	cellular response to dexa methasone stimulus	IEA	biological_process
GO:1903243	negative regulation of ca rdiac muscle hypertrophy in response to stress	IEA	biological_process
GO:0005096	GTPase activator activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0006950	response to stress	TAS	biological_process
GO:0007175	negative regulation of ep idermal growth factor-act ivated receptor activity	ISS	biological_process
GO:0007175	negative regulation of ep idermal growth factor-act ivated receptor activity	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	ISS	cellular_component
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IBA	cellular_component
GO:0031953	negative regulation of pr otein autophosphorylation	IDA	biological_process
GO:0043589	skin morphogenesis	ISS	biological_process
GO:0045616	regulation of keratinocyt e differentiation	ISS	biological_process
GO:0045616	regulation of keratinocyt e differentiation	IBA	biological_process
GO:0048286	lung alveolus development	ISS	biological_process
GO:0060426	lung vasculature developm ent	ISS	biological_process
GO:0060428	lung epithelium developme nt	ISS	biological_process

Diseases

Associated diseases	References
Endometriosis	PMID: 17510236
Endometriosis	INFBASE17510236

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17510236	Endometrio sis					FOXO1A MIG6 and CYP26A1	Show abstract