Endometriosis Knowledgebase

Search Result

Gene id

54361

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

WNT4 Gene UCSC Ensembl

Aliases

SERKAL, WNT-4

Gene name

Wnt family member 4

Alternate names

protein Wnt-4, wingless-type MMTV integration site family, member 4,

Gene location

1p36.12 (22143980: 22117304) Exons: 8 NC_000001.11

Gene summary(Entrez)

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family, and is the first signaling molecule shown to influence the sex-determination cascade. It encodes a protein which shows 98% amino acid identity to the Wnt4 protein of mouse and rat. This gene and a nuclear receptor known to antagonize the testis-determining factor play a concerted role in both the control of female development and the prevention of testes formation. This gene and another two family members, WNT2 and WNT7B, may be associated with abnormal proliferation in breast tissue. Mutations in this gene can result in Rokitansky-Kuster-Hauser syndrome and in SERKAL syndrome. [provided by RefSeq, Jul 2008]

OMIM

603490

SNPs

rs2235529

Strand: -   Allele origin: unknown  Allele change: A/G   Mutation type: snp

NC_000001.10   g.22450487C>T
NC_000001.11   g.22123994C>T
NG_008974.1   g.24033G>A
NM_030761.4   c.314-2418G>A
XM_005245897.1   c.149-2418G>A
XM_005245898.1   c.149-2418G>A
XM_011541597.2   c.380-2418G>A
XM_011541598.2   c.149-2418G>A
rs3820282

Strand: -   Allele origin: unknown  Allele change: A/G   Mutation type: snp

NC_000001.11   g.22141722C>T
NC_000001.10   g.22468215C>T
NG_008974.1   g.6305G>A
NM_030761.4   c.77+1124G>A
XM_005245897.1   c.-1617G>A
XM_005245898.1   c.-89+2010G>A
XM_011541598.2   c.-89+2010G>A
XM_011541599.1   c.-922G>A
XM_011541597.2   c.-922G>A
XR_001737923.1   n.-12

Protein Summary

Protein general information

P56705

Name: Protein Wnt 4

Length: 351 Mass: 39,052

Sequence

MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRGAQLAI
EECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGF
QWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVP
PFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR

Structural information

Interpro:	IPR005817 IPR009142 IPR018161
Prosite:	PS00246
Pfam:	PF00110
STRING:	ENSP00000290167;

Other Databases

GeneCards: WNT4; Malacards: WNT4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001658	branching involved in ure teric bud morphogenesis	IEA	biological_process
GO:0001822	kidney development	IEP	biological_process
GO:0001837	epithelial to mesenchymal transition	IEP	biological_process
GO:0001838	embryonic epithelial tube formation	IEA	biological_process
GO:0001889	liver development	IEP	biological_process
GO:0003714	transcription corepressor activity	ISS	molecular_function
GO:0005109	frizzled binding	IBA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006702	androgen biosynthetic pro cess	IDA	biological_process
GO:0008584	male gonad development	IMP	biological_process
GO:0008584	male gonad development	IEP	biological_process
GO:0008585	female gonad development	ISS	biological_process
GO:0009267	cellular response to star vation	IEA	biological_process
GO:0009986	cell surface	ISS	cellular_component
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010894	negative regulation of st eroid biosynthetic proces s	IDA	biological_process
GO:0010894	negative regulation of st eroid biosynthetic proces s	IDA	biological_process
GO:0010894	negative regulation of st eroid biosynthetic proces s	IDA	biological_process
GO:0016055	Wnt signaling pathway	TAS	biological_process
GO:0022407	regulation of cell-cell a dhesion	IEA	biological_process
GO:0030182	neuron differentiation	IBA	biological_process
GO:0030237	female sex determination	IMP	biological_process
GO:0030325	adrenal gland development	IEP	biological_process
GO:0030336	negative regulation of ce ll migration	IEA	biological_process
GO:0030501	positive regulation of bo ne mineralization	IDA	biological_process
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0032349	positive regulation of al dosterone biosynthetic pr ocess	IDA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0033080	immature T cell prolifera tion in thymus	IEA	biological_process
GO:0038030	non-canonical Wnt signali ng pathway via MAPK casca de	IDA	biological_process
GO:0040037	negative regulation of fi broblast growth factor re ceptor signaling pathway	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0045165	cell fate commitment	IBA	biological_process
GO:0045596	negative regulation of ce ll differentiation	IEA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IDA	biological_process
GO:0045836	positive regulation of me iotic nuclear division	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0048018	receptor agonist activity	IC	molecular_function
GO:0048599	oocyte development	IEA	biological_process
GO:0051145	smooth muscle cell differ entiation	IEA	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IEA	biological_process
GO:0051894	positive regulation of fo cal adhesion assembly	IEA	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0060126	somatotropin secreting ce ll differentiation	IEA	biological_process
GO:0060129	thyroid-stimulating hormo ne-secreting cell differe ntiation	IEA	biological_process
GO:0060231	mesenchymal to epithelial transition	IEA	biological_process
GO:0060748	tertiary branching involv ed in mammary gland duct morphogenesis	IEA	biological_process
GO:0061045	negative regulation of wo und healing	IEA	biological_process
GO:0061180	mammary gland epithelium development	IEP	biological_process
GO:0061184	positive regulation of de rmatome development	IDA	biological_process
GO:0061205	paramesonephric duct deve lopment	IMP	biological_process
GO:0061369	negative regulation of te sticular blood vessel mor phogenesis	IMP	biological_process
GO:0070062	extracellular exosome	TAS	cellular_component
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEP	biological_process
GO:0072033	renal vesicle formation	IEA	biological_process
GO:0072034	renal vesicle induction	IEA	biological_process
GO:0072162	metanephric mesenchymal c ell differentiation	NAS	biological_process
GO:0072174	metanephric tubule format ion	IEA	biological_process
GO:0072273	metanephric nephron morph ogenesis	IEA	biological_process
GO:0090002	establishment of protein localization to plasma me mbrane	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:2000019	negative regulation of ma le gonad development	IMP	biological_process
GO:2000066	positive regulation of co rtisol biosynthetic proce ss	IDA	biological_process
GO:2000225	negative regulation of te stosterone biosynthetic p rocess	IMP	biological_process
GO:2001234	negative regulation of ap optotic signaling pathway	IEA	biological_process
GO:0001656	metanephros development	IEA	biological_process
GO:0001658	branching involved in ure teric bud morphogenesis	IEA	biological_process
GO:0001822	kidney development	IEP	biological_process
GO:0001823	mesonephros development	IEA	biological_process
GO:0001837	epithelial to mesenchymal transition	IEP	biological_process
GO:0001838	embryonic epithelial tube formation	IEA	biological_process
GO:0001889	liver development	IEP	biological_process
GO:0003714	transcription corepressor activity	IEA	molecular_function
GO:0003714	transcription corepressor activity	ISS	molecular_function
GO:0005102	receptor binding	IEA	molecular_function
GO:0005109	frizzled binding	IEA	molecular_function
GO:0005109	frizzled binding	IBA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006702	androgen biosynthetic pro cess	IDA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007276	gamete generation	IEA	biological_process
GO:0007548	sex differentiation	IEA	biological_process
GO:0008584	male gonad development	IEA	biological_process
GO:0008584	male gonad development	IMP	biological_process
GO:0008584	male gonad development	IEP	biological_process
GO:0008585	female gonad development	IEA	biological_process
GO:0008585	female gonad development	ISS	biological_process
GO:0009267	cellular response to star vation	IEA	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0009986	cell surface	ISS	cellular_component
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010894	negative regulation of st eroid biosynthetic proces s	IDA	biological_process
GO:0010894	negative regulation of st eroid biosynthetic proces s	IDA	biological_process
GO:0010894	negative regulation of st eroid biosynthetic proces s	IDA	biological_process
GO:0016055	Wnt signaling pathway	IEA	biological_process
GO:0016055	Wnt signaling pathway	IEA	biological_process
GO:0016055	Wnt signaling pathway	TAS	biological_process
GO:0022407	regulation of cell-cell a dhesion	IEA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030182	neuron differentiation	IBA	biological_process
GO:0030237	female sex determination	IMP	biological_process
GO:0030325	adrenal gland development	IEP	biological_process
GO:0030336	negative regulation of ce ll migration	IEA	biological_process
GO:0030501	positive regulation of bo ne mineralization	IDA	biological_process
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0032349	positive regulation of al dosterone biosynthetic pr ocess	IDA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0033077	T cell differentiation in thymus	IEA	biological_process
GO:0033080	immature T cell prolifera tion in thymus	IEA	biological_process
GO:0035239	tube morphogenesis	IEA	biological_process
GO:0035567	non-canonical Wnt signali ng pathway	IEA	biological_process
GO:0038030	non-canonical Wnt signali ng pathway via MAPK casca de	IDA	biological_process
GO:0040037	negative regulation of fi broblast growth factor re ceptor signaling pathway	IEA	biological_process
GO:0042445	hormone metabolic process	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0045165	cell fate commitment	IEA	biological_process
GO:0045165	cell fate commitment	IBA	biological_process
GO:0045596	negative regulation of ce ll differentiation	IEA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IDA	biological_process
GO:0045836	positive regulation of me iotic nuclear division	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0048018	receptor agonist activity	IC	molecular_function
GO:0048599	oocyte development	IEA	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IEA	biological_process
GO:0048856	anatomical structure deve lopment	IEA	biological_process
GO:0051145	smooth muscle cell differ entiation	IEA	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IEA	biological_process
GO:0051894	positive regulation of fo cal adhesion assembly	IEA	biological_process
GO:0060070	canonical Wnt signaling p athway	IEA	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0060126	somatotropin secreting ce ll differentiation	IEA	biological_process
GO:0060129	thyroid-stimulating hormo ne-secreting cell differe ntiation	IEA	biological_process
GO:0060231	mesenchymal to epithelial transition	IEA	biological_process
GO:0060748	tertiary branching involv ed in mammary gland duct morphogenesis	IEA	biological_process
GO:0060993	kidney morphogenesis	IEA	biological_process
GO:0061045	negative regulation of wo und healing	IEA	biological_process
GO:0061180	mammary gland epithelium development	IEP	biological_process
GO:0061184	positive regulation of de rmatome development	IDA	biological_process
GO:0061205	paramesonephric duct deve lopment	IEA	biological_process
GO:0061205	paramesonephric duct deve lopment	IMP	biological_process
GO:0061369	negative regulation of te sticular blood vessel mor phogenesis	IMP	biological_process
GO:0070062	extracellular exosome	TAS	cellular_component
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEP	biological_process
GO:0072006	nephron development	IEA	biological_process
GO:0072033	renal vesicle formation	IEA	biological_process
GO:0072034	renal vesicle induction	IEA	biological_process
GO:0072162	metanephric mesenchymal c ell differentiation	NAS	biological_process
GO:0072164	mesonephric tubule develo pment	IEA	biological_process
GO:0072174	metanephric tubule format ion	IEA	biological_process
GO:0072210	metanephric nephron devel opment	IEA	biological_process
GO:0072273	metanephric nephron morph ogenesis	IEA	biological_process
GO:0090002	establishment of protein localization to plasma me mbrane	IEA	biological_process
GO:0090002	establishment of protein localization to plasma me mbrane	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:2000019	negative regulation of ma le gonad development	IMP	biological_process
GO:2000066	positive regulation of co rtisol biosynthetic proce ss	IDA	biological_process
GO:2000225	negative regulation of te stosterone biosynthetic p rocess	IEA	biological_process
GO:2000225	negative regulation of te stosterone biosynthetic p rocess	IMP	biological_process
GO:2001234	negative regulation of ap optotic signaling pathway	IEA	biological_process
GO:0001822	kidney development	IEP	biological_process
GO:0001837	epithelial to mesenchymal transition	IEP	biological_process
GO:0001889	liver development	IEP	biological_process
GO:0003714	transcription corepressor activity	ISS	molecular_function
GO:0005109	frizzled binding	IBA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006702	androgen biosynthetic pro cess	IDA	biological_process
GO:0008584	male gonad development	IMP	biological_process
GO:0008584	male gonad development	IEP	biological_process
GO:0008585	female gonad development	ISS	biological_process
GO:0009986	cell surface	ISS	cellular_component
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010894	negative regulation of st eroid biosynthetic proces s	IDA	biological_process
GO:0010894	negative regulation of st eroid biosynthetic proces s	IDA	biological_process
GO:0010894	negative regulation of st eroid biosynthetic proces s	IDA	biological_process
GO:0016055	Wnt signaling pathway	TAS	biological_process
GO:0030182	neuron differentiation	IBA	biological_process
GO:0030237	female sex determination	IMP	biological_process
GO:0030325	adrenal gland development	IEP	biological_process
GO:0030501	positive regulation of bo ne mineralization	IDA	biological_process
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0032349	positive regulation of al dosterone biosynthetic pr ocess	IDA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0038030	non-canonical Wnt signali ng pathway via MAPK casca de	IDA	biological_process
GO:0045165	cell fate commitment	IBA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0048018	receptor agonist activity	IC	molecular_function
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0061180	mammary gland epithelium development	IEP	biological_process
GO:0061184	positive regulation of de rmatome development	IDA	biological_process
GO:0061205	paramesonephric duct deve lopment	IMP	biological_process
GO:0061369	negative regulation of te sticular blood vessel mor phogenesis	IMP	biological_process
GO:0070062	extracellular exosome	TAS	cellular_component
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEP	biological_process
GO:0072162	metanephric mesenchymal c ell differentiation	NAS	biological_process
GO:0090002	establishment of protein localization to plasma me mbrane	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:2000019	negative regulation of ma le gonad development	IMP	biological_process
GO:2000066	positive regulation of co rtisol biosynthetic proce ss	IDA	biological_process
GO:2000225	negative regulation of te stosterone biosynthetic p rocess	IMP	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa05166  HTLV-I infection
hsa05205  Proteoglycans in cancer
hsa05224  Breast cancer
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04390  Hippo signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04360  Axon guidance
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04916  Melanogenesis
hsa05217  Basal cell carcinoma

Diseases

Associated diseases	References
Cancer	PMID: 20852632
Congenital adrenal hyperplasia	KEGG: H00216
Endometriosis	PMID: 23472165
Hyperandrogenism	PMID: 18182450
Subfertility	INFBASE25296917
Endometriosis	INFBASE20601957
Mayer-Rokitansky-Kuster-Hauser syndrome	PMID: 21377155
Mullerian anomaly	PMID: 22503279
Mullerian aplasia and hyperandrogenism	OMIM: 603490
Myopathy	KEGG: H00595
Polycystic ovary syndrome (PCOS)	PMID: 17071531
Preeclampsia	PMID: 26848991
Premature ovarian failure ( POF)	PMID: 21624127
Primary amenorrhea	PMID: 18182450
SERKAL syndrome	OMIM: 603490
Ulcerative colitis	PMID: 19915572

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23472165	Endometrio sis	LINC00339-WNT4 (rs2235529), RND3-RBM43 (rs1519761, rs6757804)	Europea n	16490 (2,019 su rgically confir med endometrios is cases, 14,47 1 controls)	Female infertility	LINC00339-WNT4 RND3-RBM43	Show abstract
24661731	Endometrio sis			69 (30 with end ometriosis, 39 women undergoin g ICSI for male infertility)		WNT4 WNT5a WNT1 ?-catenin BMP4	Show abstract
22259059	Endometrio sis						Show abstract
25682310	Endometrio sis	WNT4 (rs7521902 [A/C], rs16826658 [G/T], rs7515106 [C/T] and rs2235529 [A/G])	Chinese Han	1412 (646 patie nts with endome triosis, 766 no rmal controls)	Female infertility		Show abstract
25154675	Endometrio sis	CDKN2B-AS (rs10965235), WNT4 (rs16826658)	Korean	1173 (673 cases of endometrios is, 500 control s)		WNT4 CDKN2B-AS	Show abstract
20601957	Endometrio sis	rs16826658, rs10965235	Japanes e	7199 (1,907 Jap anese individua ls with endomet riosis (cases), 5,292 controls )		CDKN2BAS WNT4	Show abstract
26139156	Endometrio sis	WNT4 (rs16826658, rs3820282, rs2235529, and rs7521902)		800 (400 infert ile women with endometriosis, 400 fertile wom en as controls)	Female infertility	WNT4	Show abstract
23142796	Endometrio sis	CDKN2BAS rs1333049, rs7521902 close to WNT4, rs12700667 in an inter-genic region on 7p15.2 and fibronectin 1 rs1250248		3015 (305 endom etriosis patien ts and 2710 con trols)		CDKN2BAS WNT4 fibronectin 1	Show abstract
23104006	Endometrio sis	rs12700667, rs7521902, rs13394619, rs10859871, rs7739264, rs1537377	Europea n, Japa nese	13997 (4,604 en dometriosis cas es, 9,393 contr ols)		WNT4 GREB1 VEZT	Show abstract
25296917	Endometrio sis	rs12700667, WNT4 (rs7521902), rs1055144, GRB14 (rs10195252), PPARG (rs4684854), ITPR2-SSPN ( rs718314), CPEB4 (rs6861681), ADAMTS9 (rs6795735), LYPLAL1 (rs2820446 ), NISCH-STAB1 (rs498778), LY86 (rs1294421), RSPO3 (rs9491696), HOXC13 (rs1443512), TBX15-WA	Europea n	10254 (3194 cas es including 13 64 Stage B case s, 7060 control s)		GRB14 KIFAP3 WNT4 CAB39L	Show abstract