Endometriosis Knowledgebase

Search Result

Gene id

54567

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

DLL4 Gene UCSC Ensembl

Aliases

AOS6, hdelta2

Gene name

delta like canonical Notch ligand 4

Alternate names

delta-like protein 4, delta 4, delta ligand 4, delta-like 4 homolog, delta-like 4 protein, delta4, drosophila Delta homolog 4, notch ligand DLL4, notch ligand delta-2,

Gene location

15q15.1 (40929332: 40939059) Exons: 11 NC_000015.10

Gene summary(Entrez)

This gene is a homolog of the Drosophila delta gene. The delta gene family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. [provided by RefSeq, Jul 2008]

OMIM

605185

Protein Summary

Protein general information

Q9NR61

Name: Delta like protein 4 (Drosophila Delta homolog 4) (Delta4)

Length: 685 Mass: 74,605

Tissue specificity: Expressed in vascular endothelium.

Sequence

MAAASRSASGWALLLLVALWQQRAAGSGVFQLQLQEFINERGVLASGRPCEPGCRTFFRVCLKHFQAVVSPGPCT
FGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIEAWHAPGDDLRPEALPPDALISKIAIQGSLA
VGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSG
CHEQNGYCSKPAECLCRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCEHSTLSCADSPCFNGG
SCRERNQGANYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNRGPSRMCRCRPGFTGTYCELHVSDCARNPCA
HGGTCHDLENGLMCTCPAGFSGRRCEVRTSIDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLPP
SFPWVAVSLGVGLAVLLVLLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICSPRDSMYQSVCLISEE
RNECVIATEV

Structural information

Protein Domains	DSL. (173-217) EGF-like (218-251) EGF-like (252-282) EGF-like (284-322)
Interpro:	IPR001774 IPR001881 IPR013032 IPR000742 IPR000152 IPR009030 IPR011651
Prosite:	PS00010 PS51051 PS00022 PS01186 PS50026
Pfam:	PF01414 PF00008 PF07657
STRING:	ENSP00000249749;

Other Databases

GeneCards: DLL4; Malacards: DLL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0001525	angiogenesis	ISS	biological_process
GO:0001569	branching involved in blo od vessel morphogenesis	ISS	biological_process
GO:0001974	blood vessel remodeling	ISS	biological_process
GO:0003208	cardiac ventricle morphog enesis	ISS	biological_process
GO:0003209	cardiac atrium morphogene sis	ISS	biological_process
GO:0003222	ventricular trabecula myo cardium morphogenesis	ISS	biological_process
GO:0003344	pericardium morphogenesis	ISS	biological_process
GO:0005112	Notch binding	IEA	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007220	Notch receptor processing	TAS	biological_process
GO:0007601	visual perception	IEA	biological_process
GO:0008015	blood circulation	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0010596	negative regulation of en dothelial cell migration	IMP	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0030217	T cell differentiation	ISS	biological_process
GO:0035912	dorsal aorta morphogenesi s	ISS	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IMP	biological_process
GO:0044344	cellular response to fibr oblast growth factor stim ulus	IDA	biological_process
GO:0045746	negative regulation of No tch signaling pathway	ISS	biological_process
GO:0045747	positive regulation of No tch signaling pathway	ISS	biological_process
GO:0050767	regulation of neurogenesi s	IEA	biological_process
GO:0060579	ventral spinal cord inter neuron fate commitment	IMP	biological_process
GO:0061074	regulation of neural reti na development	ISS	biological_process
GO:0061314	Notch signaling involved in heart development	ISS	biological_process
GO:0072554	blood vessel lumenization	IEA	biological_process
GO:0090051	negative regulation of ce ll migration involved in sprouting angiogenesis	IMP	biological_process
GO:0090051	negative regulation of ce ll migration involved in sprouting angiogenesis	IDA	biological_process
GO:1903588	negative regulation of bl ood vessel endothelial ce ll proliferation involved in sprouting angiogenesi s	IDA	biological_process
GO:2000179	positive regulation of ne ural precursor cell proli feration	ISS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001525	angiogenesis	ISS	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001569	branching involved in blo od vessel morphogenesis	IEA	biological_process
GO:0001569	branching involved in blo od vessel morphogenesis	ISS	biological_process
GO:0001974	blood vessel remodeling	IEA	biological_process
GO:0001974	blood vessel remodeling	ISS	biological_process
GO:0003208	cardiac ventricle morphog enesis	IEA	biological_process
GO:0003208	cardiac ventricle morphog enesis	ISS	biological_process
GO:0003209	cardiac atrium morphogene sis	IEA	biological_process
GO:0003209	cardiac atrium morphogene sis	ISS	biological_process
GO:0003222	ventricular trabecula myo cardium morphogenesis	IEA	biological_process
GO:0003222	ventricular trabecula myo cardium morphogenesis	ISS	biological_process
GO:0003344	pericardium morphogenesis	IEA	biological_process
GO:0003344	pericardium morphogenesis	ISS	biological_process
GO:0005112	Notch binding	IEA	molecular_function
GO:0005112	Notch binding	TAS	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007154	cell communication	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007220	Notch receptor processing	TAS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007399	nervous system developmen t	IEA	biological_process
GO:0007601	visual perception	IEA	biological_process
GO:0008015	blood circulation	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0010596	negative regulation of en dothelial cell migration	IMP	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0030154	cell differentiation	IEA	biological_process
GO:0030217	T cell differentiation	IEA	biological_process
GO:0030217	T cell differentiation	ISS	biological_process
GO:0035912	dorsal aorta morphogenesi s	IEA	biological_process
GO:0035912	dorsal aorta morphogenesi s	ISS	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IMP	biological_process
GO:0043537	negative regulation of bl ood vessel endothelial ce ll migration	IEA	biological_process
GO:0044344	cellular response to fibr oblast growth factor stim ulus	IDA	biological_process
GO:0045746	negative regulation of No tch signaling pathway	IEA	biological_process
GO:0045746	negative regulation of No tch signaling pathway	ISS	biological_process
GO:0045747	positive regulation of No tch signaling pathway	IEA	biological_process
GO:0045747	positive regulation of No tch signaling pathway	ISS	biological_process
GO:0050767	regulation of neurogenesi s	IEA	biological_process
GO:0050896	response to stimulus	IEA	biological_process
GO:0060579	ventral spinal cord inter neuron fate commitment	IMP	biological_process
GO:0061074	regulation of neural reti na development	IEA	biological_process
GO:0061074	regulation of neural reti na development	ISS	biological_process
GO:0061314	Notch signaling involved in heart development	IEA	biological_process
GO:0061314	Notch signaling involved in heart development	ISS	biological_process
GO:0072554	blood vessel lumenization	IEA	biological_process
GO:0090051	negative regulation of ce ll migration involved in sprouting angiogenesis	IMP	biological_process
GO:0090051	negative regulation of ce ll migration involved in sprouting angiogenesis	IDA	biological_process
GO:1903588	negative regulation of bl ood vessel endothelial ce ll proliferation involved in sprouting angiogenesi s	IDA	biological_process
GO:2000179	positive regulation of ne ural precursor cell proli feration	IEA	biological_process
GO:2000179	positive regulation of ne ural precursor cell proli feration	ISS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0001525	angiogenesis	ISS	biological_process
GO:0001569	branching involved in blo od vessel morphogenesis	ISS	biological_process
GO:0001974	blood vessel remodeling	ISS	biological_process
GO:0003208	cardiac ventricle morphog enesis	ISS	biological_process
GO:0003209	cardiac atrium morphogene sis	ISS	biological_process
GO:0003222	ventricular trabecula myo cardium morphogenesis	ISS	biological_process
GO:0003344	pericardium morphogenesis	ISS	biological_process
GO:0005112	Notch binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007220	Notch receptor processing	TAS	biological_process
GO:0008015	blood circulation	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0010596	negative regulation of en dothelial cell migration	IMP	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0030217	T cell differentiation	ISS	biological_process
GO:0035912	dorsal aorta morphogenesi s	ISS	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IMP	biological_process
GO:0044344	cellular response to fibr oblast growth factor stim ulus	IDA	biological_process
GO:0045746	negative regulation of No tch signaling pathway	ISS	biological_process
GO:0045747	positive regulation of No tch signaling pathway	ISS	biological_process
GO:0060579	ventral spinal cord inter neuron fate commitment	IMP	biological_process
GO:0061074	regulation of neural reti na development	ISS	biological_process
GO:0061314	Notch signaling involved in heart development	ISS	biological_process
GO:0090051	negative regulation of ce ll migration involved in sprouting angiogenesis	IMP	biological_process
GO:0090051	negative regulation of ce ll migration involved in sprouting angiogenesis	IDA	biological_process
GO:1903588	negative regulation of bl ood vessel endothelial ce ll proliferation involved in sprouting angiogenesi s	IDA	biological_process
GO:2000179	positive regulation of ne ural precursor cell proli feration	ISS	biological_process

KEGG pathways

hsa05224  Breast cancer
hsa01522  Endocrine resistance
hsa04658  Th1 and Th2 cell differentiation
hsa04330  Notch signaling pathway

Diseases

Associated diseases	References
Endometriosis	PMID: 25546156
Endometriosis	INFBASE25546156

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25546156	Endometrio sis				Female infertility	NOTCH1 NOTCH4 JAGGED2 DLL4 HES5 HEY1	Show abstract