Endometriosis Knowledgebase

Search Result

Gene id

5468

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PPARG Gene UCSC Ensembl

Aliases

CIMT1, GLM1, NR1C3, PPARG1, PPARG2, PPARgamma

Gene name

peroxisome proliferator activated receptor gamma

Alternate names

peroxisome proliferator-activated receptor gamma, PPAR-gamma, nuclear receptor subfamily 1 group C member 3, peroxisome proliferator-activated nuclear receptor gamma variant 1,

Gene location

3p25.2 (12287849: 12471053) Exons: 11 NC_000003.12

Gene summary(Entrez)

This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq, Jul 2008]

OMIM

601487

SNPs

rs3856806

Strand:    Allele origin: T(germline)/C(germline)  Allele change: C/T   Mutation type: snp

CM000665.2   g.12434058C>T
NC_000003.11   g.12475557C>T
NC_000003.12   g.12434058C>T
NG_011749.1   g.151209C>T
NM_001330615.1   c.*143C>T
NM_001354666.1   c.1347C>T
NM_001354667.1   c.1347C>T
NM_001354669.1   c.714C>T
NM_005037.5   c.1347C>T
NM_015869.4   c.1431C>T
NM_138711.3   c.1347C>T
NM_138712.3   c.1347C>T
NP_001341595.1   p.His449=
NP_001341596.1   p.His449=
NP_001341598.1   p.His238=
NP_005028.4   p.His449=
NP_056953.2   p.His477=
NP_619725.2   p.His449=
NP_619726.2   p.His449=
XP_011532143.1   p.His449=
Clinical Significance: Likely benign

Protein Summary

Protein general information

P37231

Name: Peroxisome proliferator activated receptor gamma (PPAR gamma) (Nuclear receptor subfamily 1 group C member 3)

Length: 505 Mass: 57,620

Tissue specificity: Highest expression in adipose tissue. Lower in skeletal muscle, spleen, heart and liver. Also detectable in placenta, lung and ovary. {ECO

Sequence

MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSIST
PHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH
YGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEI
SSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGF
MTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLK
LNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY

Structural information

Interpro:	IPR003074 IPR003077 IPR000536 IPR001723 IPR022590 IPR001628 IPR013088
Prosite:	PS00031 PS51030
Pfam:	PF00104 PF12577 PF00105
PDB:	1FM6 1FM9 1I7I 1K74 1KNU 1NYX 1PRG 1RDT 1WM0 1ZEO 1ZGY 2ATH 2F4B 2FVJ 2G0G 2G0H 2GTK 2HFP 2HWQ 2HWR 2I4J 2I4P 2I4Z 2OM9 2P4Y 2POB 2PRG 2Q59 2Q5P 2Q5S 2Q61 2Q6R 2Q6S 2Q8S 2QMV 2VSR 2VST 2VV0 2VV1 2VV2 2VV3 2VV4 2XKW 2YFE 2ZK0 2ZK1 2ZK2 2ZK3 2ZK4 2ZK5 2ZK6
PDBsum:	1FM6 1FM9 1I7I 1K74 1KNU 1NYX 1PRG 1RDT 1WM0 1ZEO 1ZGY 2ATH 2F4B 2FVJ 2G0G 2G0H 2GTK 2HFP 2HWQ 2HWR 2I4J 2I4P 2I4Z 2OM9 2P4Y 2POB 2PRG 2Q59 2Q5P 2Q5S 2Q61 2Q6R 2Q6S 2Q8S 2QMV 2VSR 2VST 2VV0 2VV1 2VV2 2VV3 2VV4 2XKW 2YFE 2ZK0 2ZK1 2ZK2 2ZK3 2ZK4 2ZK5 2ZK6
DIP:	35528
STRING:	ENSP00000287820;

Other Databases

GeneCards: PPARG; Malacards: PPARG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0001046	core promoter sequence-sp ecific DNA binding	ISS	molecular_function
GO:0001890	placenta development	ISS	biological_process
GO:0002674	negative regulation of ac ute inflammatory response	IEA	biological_process
GO:0003677	DNA binding	ISS	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003682	chromatin binding	ISS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	ISS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003707	steroid hormone receptor activity	IEA	molecular_function
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	IDA	molecular_function
GO:0004955	prostaglandin receptor ac tivity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005829	cytosol	ISS	cellular_component
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological_process
GO:0006629	lipid metabolic process	TAS	biological_process
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	IDA	biological_process
GO:0007165	signal transduction	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0007584	response to nutrient	TAS	biological_process
GO:0008144	drug binding	IDA	molecular_function
GO:0008144	drug binding	IDA	molecular_function
GO:0008217	regulation of blood press ure	IMP	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0009409	response to cold	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IC	biological_process
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IDA	biological_process
GO:0010871	negative regulation of re ceptor biosynthetic proce ss	IDA	biological_process
GO:0010887	negative regulation of ch olesterol storage	IDA	biological_process
GO:0010891	negative regulation of se questering of triglycerid e	IDA	biological_process
GO:0015909	long-chain fatty acid tra nsport	ISS	biological_process
GO:0019395	fatty acid oxidation	IEA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019903	protein phosphatase bindi ng	IEA	molecular_function
GO:0030224	monocyte differentiation	IDA	biological_process
GO:0030308	negative regulation of ce ll growth	IEA	biological_process
GO:0030331	estrogen receptor binding	IEA	molecular_function
GO:0030374	ligand-dependent nuclear receptor transcription co activator activity	IDA	molecular_function
GO:0030855	epithelial cell different iation	ISS	biological_process
GO:0031000	response to caffeine	IEA	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0032526	response to retinoic acid	IDA	biological_process
GO:0032869	cellular response to insu lin stimulus	IMP	biological_process
GO:0032966	negative regulation of co llagen biosynthetic proce ss	IEA	biological_process
GO:0033189	response to vitamin A	IEA	biological_process
GO:0033613	activating transcription factor binding	IDA	molecular_function
GO:0033993	response to lipid	ISS	biological_process
GO:0035357	peroxisome proliferator a ctivated receptor signali ng pathway	IMP	biological_process
GO:0035902	response to immobilizatio n stress	IEA	biological_process
GO:0036270	response to diuretic	IEA	biological_process
GO:0042593	glucose homeostasis	IMP	biological_process
GO:0042594	response to starvation	IEA	biological_process
GO:0042752	regulation of circadian r hythm	ISS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042953	lipoprotein transport	IDA	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0044212	transcription regulatory region DNA binding	ISS	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045087	innate immune response	TAS	biological_process
GO:0045165	cell fate commitment	ISS	biological_process
GO:0045600	positive regulation of fa t cell differentiation	ISS	biological_process
GO:0045713	low-density lipoprotein p article receptor biosynth etic process	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046321	positive regulation of fa tty acid oxidation	IEA	biological_process
GO:0046965	retinoid X receptor bindi ng	IDA	molecular_function
GO:0048469	cell maturation	IDA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048511	rhythmic process	IEA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0048714	positive regulation of ol igodendrocyte differentia tion	IEA	biological_process
GO:0050544	arachidonic acid binding	ISS	molecular_function
GO:0050872	white fat cell differenti ation	ISS	biological_process
GO:0050872	white fat cell differenti ation	TAS	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051393	alpha-actinin binding	IPI	molecular_function
GO:0051974	negative regulation of te lomerase activity	IEA	biological_process
GO:0055088	lipid homeostasis	TAS	biological_process
GO:0055098	response to low-density l ipoprotein particle	IDA	biological_process
GO:0060100	positive regulation of ph agocytosis, engulfment	IEA	biological_process
GO:0060336	negative regulation of in terferon-gamma-mediated s ignaling pathway	IMP	biological_process
GO:0060694	regulation of cholesterol transporter activity	IC	biological_process
GO:0060850	regulation of transcripti on involved in cell fate commitment	ISS	biological_process
GO:0071300	cellular response to reti noic acid	IEA	biological_process
GO:0071306	cellular response to vita min E	IEA	biological_process
GO:0071380	cellular response to pros taglandin E stimulus	IEA	biological_process
GO:0071455	cellular response to hype roxia	IEA	biological_process
GO:0090575	RNA polymerase II transcr iption factor complex	IDA	cellular_component
GO:1901558	response to metformin	IEA	biological_process
GO:2000230	negative regulation of pa ncreatic stellate cell pr oliferation	IEA	biological_process
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0001046	core promoter sequence-sp ecific DNA binding	ISS	molecular_function
GO:0001890	placenta development	ISS	biological_process
GO:0002674	negative regulation of ac ute inflammatory response	IEA	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	ISS	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003682	chromatin binding	ISS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	ISS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003707	steroid hormone receptor activity	IEA	molecular_function
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	IEA	molecular_function
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	IDA	molecular_function
GO:0004955	prostaglandin receptor ac tivity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	ISS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IEA	biological_process
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological_process
GO:0006629	lipid metabolic process	TAS	biological_process
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	IDA	biological_process
GO:0007165	signal transduction	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0007584	response to nutrient	TAS	biological_process
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0008144	drug binding	IDA	molecular_function
GO:0008144	drug binding	IDA	molecular_function
GO:0008217	regulation of blood press ure	IMP	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0009409	response to cold	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IC	biological_process
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IDA	biological_process
GO:0010871	negative regulation of re ceptor biosynthetic proce ss	IDA	biological_process
GO:0010887	negative regulation of ch olesterol storage	IDA	biological_process
GO:0010891	negative regulation of se questering of triglycerid e	IDA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0015909	long-chain fatty acid tra nsport	ISS	biological_process
GO:0019216	regulation of lipid metab olic process	IEA	biological_process
GO:0019395	fatty acid oxidation	IEA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019903	protein phosphatase bindi ng	IEA	molecular_function
GO:0030224	monocyte differentiation	IDA	biological_process
GO:0030308	negative regulation of ce ll growth	IEA	biological_process
GO:0030331	estrogen receptor binding	IEA	molecular_function
GO:0030374	ligand-dependent nuclear receptor transcription co activator activity	IDA	molecular_function
GO:0030855	epithelial cell different iation	ISS	biological_process
GO:0031000	response to caffeine	IEA	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0032526	response to retinoic acid	IDA	biological_process
GO:0032869	cellular response to insu lin stimulus	IMP	biological_process
GO:0032966	negative regulation of co llagen biosynthetic proce ss	IEA	biological_process
GO:0033189	response to vitamin A	IEA	biological_process
GO:0033613	activating transcription factor binding	IDA	molecular_function
GO:0033993	response to lipid	IEA	biological_process
GO:0033993	response to lipid	ISS	biological_process
GO:0035357	peroxisome proliferator a ctivated receptor signali ng pathway	IMP	biological_process
GO:0035902	response to immobilizatio n stress	IEA	biological_process
GO:0036270	response to diuretic	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042593	glucose homeostasis	IMP	biological_process
GO:0042594	response to starvation	IEA	biological_process
GO:0042752	regulation of circadian r hythm	ISS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042953	lipoprotein transport	IDA	biological_process
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological_process
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0043627	response to estrogen	IEA	biological_process
GO:0044212	transcription regulatory region DNA binding	IEA	molecular_function
GO:0044212	transcription regulatory region DNA binding	ISS	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045087	innate immune response	TAS	biological_process
GO:0045165	cell fate commitment	ISS	biological_process
GO:0045598	regulation of fat cell di fferentiation	IEA	biological_process
GO:0045600	positive regulation of fa t cell differentiation	ISS	biological_process
GO:0045713	low-density lipoprotein p article receptor biosynth etic process	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046321	positive regulation of fa tty acid oxidation	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046965	retinoid X receptor bindi ng	IDA	molecular_function
GO:0048469	cell maturation	IDA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048511	rhythmic process	IEA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0048714	positive regulation of ol igodendrocyte differentia tion	IEA	biological_process
GO:0050544	arachidonic acid binding	ISS	molecular_function
GO:0050872	white fat cell differenti ation	ISS	biological_process
GO:0050872	white fat cell differenti ation	TAS	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051393	alpha-actinin binding	IPI	molecular_function
GO:0051974	negative regulation of te lomerase activity	IEA	biological_process
GO:0055088	lipid homeostasis	TAS	biological_process
GO:0055098	response to low-density l ipoprotein particle	IDA	biological_process
GO:0060100	positive regulation of ph agocytosis, engulfment	IEA	biological_process
GO:0060336	negative regulation of in terferon-gamma-mediated s ignaling pathway	IMP	biological_process
GO:0060694	regulation of cholesterol transporter activity	IC	biological_process
GO:0060850	regulation of transcripti on involved in cell fate commitment	ISS	biological_process
GO:0071300	cellular response to reti noic acid	IEA	biological_process
GO:0071306	cellular response to vita min E	IEA	biological_process
GO:0071379	cellular response to pros taglandin stimulus	IEA	biological_process
GO:0071380	cellular response to pros taglandin E stimulus	IEA	biological_process
GO:0071455	cellular response to hype roxia	IEA	biological_process
GO:0090575	RNA polymerase II transcr iption factor complex	IDA	cellular_component
GO:1901558	response to metformin	IEA	biological_process
GO:2000230	negative regulation of pa ncreatic stellate cell pr oliferation	IEA	biological_process
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0001046	core promoter sequence-sp ecific DNA binding	ISS	molecular_function
GO:0001890	placenta development	ISS	biological_process
GO:0003677	DNA binding	ISS	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003682	chromatin binding	ISS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	ISS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	IDA	molecular_function
GO:0004955	prostaglandin receptor ac tivity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005829	cytosol	ISS	cellular_component
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological_process
GO:0006629	lipid metabolic process	TAS	biological_process
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	IDA	biological_process
GO:0007165	signal transduction	IDA	biological_process
GO:0007584	response to nutrient	TAS	biological_process
GO:0008144	drug binding	IDA	molecular_function
GO:0008144	drug binding	IDA	molecular_function
GO:0008217	regulation of blood press ure	IMP	biological_process
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IC	biological_process
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IDA	biological_process
GO:0010871	negative regulation of re ceptor biosynthetic proce ss	IDA	biological_process
GO:0010887	negative regulation of ch olesterol storage	IDA	biological_process
GO:0010891	negative regulation of se questering of triglycerid e	IDA	biological_process
GO:0015909	long-chain fatty acid tra nsport	ISS	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030224	monocyte differentiation	IDA	biological_process
GO:0030374	ligand-dependent nuclear receptor transcription co activator activity	IDA	molecular_function
GO:0030855	epithelial cell different iation	ISS	biological_process
GO:0032526	response to retinoic acid	IDA	biological_process
GO:0032869	cellular response to insu lin stimulus	IMP	biological_process
GO:0033613	activating transcription factor binding	IDA	molecular_function
GO:0033993	response to lipid	ISS	biological_process
GO:0035357	peroxisome proliferator a ctivated receptor signali ng pathway	IMP	biological_process
GO:0042593	glucose homeostasis	IMP	biological_process
GO:0042752	regulation of circadian r hythm	ISS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042953	lipoprotein transport	IDA	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0044212	transcription regulatory region DNA binding	ISS	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045087	innate immune response	TAS	biological_process
GO:0045165	cell fate commitment	ISS	biological_process
GO:0045600	positive regulation of fa t cell differentiation	ISS	biological_process
GO:0045713	low-density lipoprotein p article receptor biosynth etic process	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046965	retinoid X receptor bindi ng	IDA	molecular_function
GO:0048469	cell maturation	IDA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050544	arachidonic acid binding	ISS	molecular_function
GO:0050872	white fat cell differenti ation	ISS	biological_process
GO:0050872	white fat cell differenti ation	TAS	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051393	alpha-actinin binding	IPI	molecular_function
GO:0055088	lipid homeostasis	TAS	biological_process
GO:0055098	response to low-density l ipoprotein particle	IDA	biological_process
GO:0060336	negative regulation of in terferon-gamma-mediated s ignaling pathway	IMP	biological_process
GO:0060694	regulation of cholesterol transporter activity	IC	biological_process
GO:0060850	regulation of transcripti on involved in cell fate commitment	ISS	biological_process
GO:0090575	RNA polymerase II transcr iption factor complex	IDA	cellular_component
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function

KEGG pathways

hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa04380  Osteoclast differentiation
hsa05016  Huntington's disease
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa05216  Thyroid cancer
hsa03320  PPAR signaling pathway

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 17440948
Amyotrophic lateral sclerosis (ALS)	PMID: 18513389
Asthma	PMID: 19217272
Atherosclerosis	PMID: 15128052
Bladder cancer	PMID: 16110031
Brain Ischemia	PMID: 19131662
Breast cancer	PMID: 16959787
Chronic kidney failure	PMID: 19578796
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Colorectal cancer	PMID: 12839942
Crohn's disease	PMID: 20650551
Dementia	PMID: 20640553
Depression	PMID: 19766907
Diabetes	PMID: 12375694
Diabetic angiopathy	PMID: 19651920
Endometriosis	PMID: 20560917
Familial partial lipodystrophy	KEGG: H00420
Female infertility	PMID: 21764381
Functional�ovarian�hyperandrogenism	PMID: 16541712
Glomerulonephritis	PMID: 14616762
Graves disease	PMID: 18624999
Growth disorder	PMID: 19808901
Hearing loss	PMID: 19898482
Heart disease	PMID: 15699916
Hyperandrogenism	PMID: 16541712
Hypertension	PMID: 12544508
Hypertriglyceridemia	PMID: 16630553
Hypertrophy	PMID: 15649578
Inflammatory bowel disease	PMID: 19104705
Left ventricular hypertrophy	PMID: 14671555
Lipodystrophy	OMIM: 601487
Lung cancer	PMID: 14604894
Lupus erythematosus	PMID: 15934434
Male infertility	PMID: 18443916
Metabolic syndrome	PMID: 18370824
Miscarriage	PMID: 19342081
Multiple sclerosis	PMID: 18977277
Female infertility	INFBASE12620489
Endometriosis	INFBASE11443174
Obesity	PMID: 12744304
Osteoporosis	PMID: 15846185
Peripheral vascular diseases	PMID: 19435865
Polycystic ovary syndrome (PCOS)	PMID: 22738153
Prostate cancer	PMID: 12609711
Psoriasis	PMID: 15083308
Rheumatoid arthritis	PMID: 19199260
Sarcoidosis	PMID: 19070258
Schizophrenia	PMID: 19193342
Ulcerative colitis	PMID: 18507082
Wegener granulomatosis	PMID: 19223982

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
20560917	Endometrio sis	PPAR-G2 (P12A)	Korean	873 (446 patien ts, 427 control s)		PPAR-G2	Show abstract
12620489	Endometrio sis				Female infertility		Show abstract
11443174	Endometrio sis					PPAR-alpha PPAR-gamma	Show abstract