Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 55521
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary
Gene Symbol TRIM36   Gene   UCSC   Ensembl
Aliases HAPRIN, RBCC728, RNF98
Gene name tripartite motif containing 36
Alternate names E3 ubiquitin-protein ligase TRIM36, RING finger protein 98, RING-type E3 ubiquitin transferase TRIM36, tripartite motif protein 36, tripartite motif-containing protein 36, zinc-binding protein Rbcc728,
Gene location 5q22.3 (115180545: 115124761)     Exons: 16     NC_000005.10
Gene summary(Entrez) The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
OMIM 609317

Protein Summary
Protein general information Q9NQ86  

Name: E3 ubiquitin protein ligase TRIM36 (EC 2.3.2.27) (RING finger protein 98) (RING type E3 ubiquitin transferase TRIM36) (Tripartite motif containing protein 36) (Zinc binding protein Rbcc728)

Length: 728  Mass: 83,013

Tissue specificity: Highly expressed in testis, prostate and brain. Weakly expressed in kidney, lung and heart. {ECO

Sequence MSESGEMSEFGYIMELIAKGKVTIKNIERELICPACKELFTHPLILPCQHSICHKCVKELLLTLDDSFNDVGSDN
SNQSSPRLRLPSPSMDKIDRINRPGWKRNSLTPRTTVFPCPGCEHDVDLGERGINGLFRNFTLETIVERYRQAAR
AATAIMCDLCKPPPQESTKSCMDCSASYCNECFKIHHPWGTIKAQHEYVGPTTNFRPKILMCPEHETERINMYCE
LCRRPVCHLCKLGGNHANHRVTTMSSAYKTLKEKLSKDIDYLIGKESQVKSQISELNLLMKETECNGERAKEEAI
THFEKLFEVLEERKSSVLKAIDSSKKLRLDKFQTQMEEYQGLLENNGLVGYAQEVLKETDQSCFVQTAKQLHLRI
QKATESLKSFRPAAQTSFEDYVVNTSKQTELLGELSFFSSGIDVPEINEEQSKVYNNALINWHHPEKDKADSYVL
EYRKINRDDEMSWNEIEVCGTSKIIQDLENSSTYAFRVRAYKGSICSPCSRELILHTPPAPVFSFLFDEKCGYNN
EHLLLNLKRDRVESRAGFNLLLAAERIQVGYYTSLDYIIGDTGITKGKHFWAFRVEPYSYLVKVGVASSDKLQEW
LRSPRDAVSPRYEQDSGHDSGSEDACFDSSQPFTLVTIGMQKFFIPKSPTSSNEPENRVLPMPTSIGIFLDCDKG
KVDFYDMDQMKCLYERQVDCSHTLYPAFALMGSGGIQLEEPITAKYLEYQEDM
Structural information
Protein Domains
 COS. (356-413)
Fibronectin (419-510)
B30.2/SPRY. (508-720)
Interpro:  IPR001870 IPR003879 IPR013320 IPR017903 IPR003961 IPR013783 IPR027726 IPR027370 IPR000315 IPR001841 IPR013083 IPR017907
Prosite:   PS50188 PS51262 PS50853 PS50119 PS00518 PS50089

Pfam:  		 PF00041 PF00643 PF13445
CDD:   cd00063 cd00162
STRING:   ENSP00000282369;
Other Databases GeneCards:  TRIM36;  Malacards:  TRIM36

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000209 protein polyubiquitinatio
n
 TAS biological_process
GO:0001669 acrosomal vesicle
 IEA cellular_component
GO:0004842 ubiquitin-protein transfe
rase activity
 EXP molecular_function
GO:0004842 ubiquitin-protein transfe
rase activity
 TAS molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005856 cytoskeleton
 IEA cellular_component
GO:0007340 acrosome reaction
 IEA biological_process
GO:0008270 zinc ion binding
 IEA molecular_function
GO:0016874 ligase activity
 IEA molecular_function
GO:0051726 regulation of cell cycle
 IEA biological_process
GO:0070062 extracellular exosome
 IDA cellular_component
GO:0000209 protein polyubiquitinatio
n
 TAS biological_process
GO:0001669 acrosomal vesicle
 IEA cellular_component
GO:0001669 acrosomal vesicle
 IEA cellular_component
GO:0004842 ubiquitin-protein transfe
rase activity
 IEA molecular_function
GO:0004842 ubiquitin-protein transfe
rase activity
 EXP molecular_function
GO:0004842 ubiquitin-protein transfe
rase activity
 TAS molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005622 intracellular
 IEA cellular_component
GO:0005737 cytoplasm
 IEA cellular_component
GO:0005737 cytoplasm
 IEA cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005856 cytoskeleton
 IEA cellular_component
GO:0005856 cytoskeleton
 IEA cellular_component
GO:0007340 acrosome reaction
 IEA biological_process
GO:0008270 zinc ion binding
 IEA molecular_function
GO:0016874 ligase activity
 IEA molecular_function
GO:0031410 cytoplasmic vesicle
 IEA cellular_component
GO:0046872 metal ion binding
 IEA molecular_function
GO:0051726 regulation of cell cycle
 IEA biological_process
GO:0070062 extracellular exosome
 IDA cellular_component
GO:0000209 protein polyubiquitinatio
n
 TAS biological_process
GO:0004842 ubiquitin-protein transfe
rase activity
 EXP molecular_function
GO:0004842 ubiquitin-protein transfe
rase activity
 TAS molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0070062 extracellular exosome
 IDA cellular_component

Diseases

Associated diseases References
Endometriosis (ovarian) PMID: 25298284
Ovarian endometriosis INFBASE25298284
Ovarian endometriosis PMID: 25298284
Ovarian endometriosis PMID: 25298284

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
25298284 Endometrio
sis (ovari
an)
50 (30 EMS-asso
ciated ovarian
carcinoma (18 O
varian endometr
ioid cancer, 12
ovarian clear
cell cancer), 2
0 normal endome
trial specimens
)
 Female infertility RASSF2
RUNX3
GSTZ1
CYP2A
GBGT1
NDUFS1
SPOCK2
ADAM22
and TRIM36
 Show abstract