Endometriosis Knowledgebase

Search Result

Gene id

5579

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PRKCB Gene UCSC Ensembl

Aliases

PKC-beta, PKCB, PRKCB1, PRKCB2

Gene name

protein kinase C beta

Alternate names

protein kinase C beta type, PKC-B, protein kinase C, beta 1 polypeptide,

Gene location

16p12.2-p12.1 (7117813: 6941743) Exons: 64 NC_000018.10

Gene summary(Entrez)

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This protein kinase has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption. Studies in mice also suggest that this kinase may also regulate neuronal functions and correlate fear-induced conflict behavior after stress. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

OMIM

176970

Protein Summary

Protein general information

P05771

Name: Protein kinase C beta type (PKC-B) (PKC-beta) (EC 2.7.11.13)

Length: 671 Mass: 76,869

Sequence

MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVH
KRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSL
CGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNE
TFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEE
LRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKK
DVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEI
AIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWW
AFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV

Structural information

Protein Domains	C2. (173-260) Protein (342-600) AGC-kinase (601-671)
Interpro:	IPR000961 IPR000008 IPR035892 IPR034664 IPR020454 IPR011009 IPR002219 IPR017892 IPR000719 IPR017441 IPR014375 IPR008271
Prosite:	PS51285 PS50004 PS00107 PS50011 PS00108 PS00479 PS50081
Pfam:	PF00130 PF00168 PF00069 PF00433
CDD:	cd00029 cd05616
PDB:	2I0E
PDBsum:	2I0E
DIP:	34187
MINT:
STRING:	ENSP00000305355;

Other Databases

GeneCards: PRKCB; Malacards: PRKCB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001666	response to hypoxia	IEA	biological_process
GO:0002250	adaptive immune response	IEA	biological_process
GO:0003682	chromatin binding	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004697	protein kinase C activity	TAS	molecular_function
GO:0004698	calcium-dependent protein kinase C activity	TAS	molecular_function
GO:0004698	calcium-dependent protein kinase C activity	TAS	molecular_function
GO:0004698	calcium-dependent protein kinase C activity	TAS	molecular_function
GO:0004698	calcium-dependent protein kinase C activity	TAS	molecular_function
GO:0005080	protein kinase C binding	IPI	molecular_function
GO:0005246	calcium channel regulator activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IMP	biological_process
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0006816	calcium ion transport	IEA	biological_process
GO:0006874	cellular calcium ion home ostasis	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological_process
GO:0007165	signal transduction	NAS	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0010829	negative regulation of gl ucose transport	ISS	biological_process
GO:0018105	peptidyl-serine phosphory lation	IBA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030374	ligand-dependent nuclear receptor transcription co activator activity	IMP	molecular_function
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	ISS	biological_process
GO:0035403	histone kinase activity ( H3-T6 specific)	IDA	molecular_function
GO:0035403	histone kinase activity ( H3-T6 specific)	IDA	molecular_function
GO:0035408	histone H3-T6 phosphoryla tion	IDA	biological_process
GO:0035408	histone H3-T6 phosphoryla tion	IDA	biological_process
GO:0035556	intracellular signal tran sduction	IBA	biological_process
GO:0042113	B cell activation	ISS	biological_process
GO:0042393	histone binding	IDA	molecular_function
GO:0042953	lipoprotein transport	TAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	ISS	biological_process
GO:0045766	positive regulation of an giogenesis	ISS	biological_process
GO:0046627	negative regulation of in sulin receptor signaling pathway	ISS	biological_process
GO:0050681	androgen receptor binding	IDA	molecular_function
GO:0050853	B cell receptor signaling pathway	ISS	biological_process
GO:0050861	positive regulation of B cell receptor signaling p athway	ISS	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071322	cellular response to carb ohydrate stimulus	IEA	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001666	response to hypoxia	IEA	biological_process
GO:0002250	adaptive immune response	IEA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0003682	chromatin binding	IDA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004697	protein kinase C activity	IEA	molecular_function
GO:0004697	protein kinase C activity	IEA	molecular_function
GO:0004697	protein kinase C activity	IEA	molecular_function
GO:0004697	protein kinase C activity	TAS	molecular_function
GO:0004697	protein kinase C activity	TAS	molecular_function
GO:0004698	calcium-dependent protein kinase C activity	TAS	molecular_function
GO:0004698	calcium-dependent protein kinase C activity	TAS	molecular_function
GO:0004698	calcium-dependent protein kinase C activity	TAS	molecular_function
GO:0004698	calcium-dependent protein kinase C activity	TAS	molecular_function
GO:0005080	protein kinase C binding	IPI	molecular_function
GO:0005246	calcium channel regulator activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IMP	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0006816	calcium ion transport	IEA	biological_process
GO:0006874	cellular calcium ion home ostasis	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological_process
GO:0007165	signal transduction	NAS	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0010829	negative regulation of gl ucose transport	IEA	biological_process
GO:0010829	negative regulation of gl ucose transport	ISS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IBA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030374	ligand-dependent nuclear receptor transcription co activator activity	IMP	molecular_function
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	IEA	biological_process
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	ISS	biological_process
GO:0035403	histone kinase activity ( H3-T6 specific)	IDA	molecular_function
GO:0035403	histone kinase activity ( H3-T6 specific)	IDA	molecular_function
GO:0035408	histone H3-T6 phosphoryla tion	IDA	biological_process
GO:0035408	histone H3-T6 phosphoryla tion	IDA	biological_process
GO:0035556	intracellular signal tran sduction	IEA	biological_process
GO:0035556	intracellular signal tran sduction	IBA	biological_process
GO:0042113	B cell activation	IEA	biological_process
GO:0042113	B cell activation	ISS	biological_process
GO:0042393	histone binding	IDA	molecular_function
GO:0042953	lipoprotein transport	TAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	ISS	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0045766	positive regulation of an giogenesis	ISS	biological_process
GO:0046627	negative regulation of in sulin receptor signaling pathway	ISS	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0050681	androgen receptor binding	IDA	molecular_function
GO:0050853	B cell receptor signaling pathway	IEA	biological_process
GO:0050853	B cell receptor signaling pathway	ISS	biological_process
GO:0050861	positive regulation of B cell receptor signaling p athway	IEA	biological_process
GO:0050861	positive regulation of B cell receptor signaling p athway	ISS	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071322	cellular response to carb ohydrate stimulus	IEA	biological_process
GO:0003682	chromatin binding	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004697	protein kinase C activity	TAS	molecular_function
GO:0004697	protein kinase C activity	TAS	molecular_function
GO:0004698	calcium-dependent protein kinase C activity	TAS	molecular_function
GO:0004698	calcium-dependent protein kinase C activity	TAS	molecular_function
GO:0004698	calcium-dependent protein kinase C activity	TAS	molecular_function
GO:0004698	calcium-dependent protein kinase C activity	TAS	molecular_function
GO:0005080	protein kinase C binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IMP	biological_process
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological_process
GO:0007165	signal transduction	NAS	biological_process
GO:0010829	negative regulation of gl ucose transport	ISS	biological_process
GO:0018105	peptidyl-serine phosphory lation	IBA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030374	ligand-dependent nuclear receptor transcription co activator activity	IMP	molecular_function
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	ISS	biological_process
GO:0035403	histone kinase activity ( H3-T6 specific)	IDA	molecular_function
GO:0035403	histone kinase activity ( H3-T6 specific)	IDA	molecular_function
GO:0035408	histone H3-T6 phosphoryla tion	IDA	biological_process
GO:0035408	histone H3-T6 phosphoryla tion	IDA	biological_process
GO:0035556	intracellular signal tran sduction	IBA	biological_process
GO:0042113	B cell activation	ISS	biological_process
GO:0042393	histone binding	IDA	molecular_function
GO:0042953	lipoprotein transport	TAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	ISS	biological_process
GO:0045766	positive regulation of an giogenesis	ISS	biological_process
GO:0046627	negative regulation of in sulin receptor signaling pathway	ISS	biological_process
GO:0050681	androgen receptor binding	IDA	molecular_function
GO:0050853	B cell receptor signaling pathway	ISS	biological_process
GO:0050861	positive regulation of B cell receptor signaling p athway	ISS	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component

Diseases

Associated diseases	References
Endometriosis	PMID: 15299092
Ovarian endometriosis	INFBASE16815388
Endometriosis	INFBASE15299092
Ovarian endometriosis	PMID: 16815388
Rheumatoid arthritis	PMID: 22446963

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16815388	Endometrio sis (ovari an)					PDGFRA PKCbeta1 JAK1 HSP90A COUP-TF2 MOR 17betaHSD2 Sprouty2 and PGE(2)EP3	Show abstract
15299092	Endometrio sis					PDGFRA PKC beta1 JAK1 Sprouty2 MKK7 COUP-TF2 PGE2EP	Show abstract