Endometriosis Knowledgebase

Search Result

Gene id

558

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

AXL Gene UCSC Ensembl

Aliases

ARK, JTK11, Tyro7, UFO

Gene name

AXL receptor tyrosine kinase

Alternate names

tyrosine-protein kinase receptor UFO, AXL oncogene, AXL transforming sequence/gene,

Gene location

19q13.2 (41219198: 41261766) Exons: 21 NC_000019.10

Gene summary(Entrez)

The protein encoded by this gene is a member of the Tyro3-Axl-Mer (TAM) receptor tyrosine kinase subfamily. The encoded protein possesses an extracellular domain which is composed of two immunoglobulin-like motifs at the N-terminal, followed by two fibronectin type-III motifs. It transduces signals from the extracellular matrix into the cytoplasm by binding to the vitamin K-dependent protein growth arrest-specific 6 (Gas6). This gene may be involved in several cellular functions including growth, migration, aggregation and anti-inflammation in multiple cell types. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]

OMIM

109135

Protein Summary

Protein general information

P30530

Name: Tyrosine protein kinase receptor UFO (EC 2.7.10.1) (AXL oncogene)

Length: 894 Mass: 98,336

Tissue specificity: Highly expressed in metastatic colon tumors. Expressed in primary colon tumors. Weakly expressed in normal colon tissue. {ECO

Sequence

MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQI
LELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTV
AANTPFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLP
QQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSNDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLH
PHTPYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQD
TPEVLMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPVHQLVKEPSTPAFSWPW
WYVLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELKEK
LRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRL
IGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAA
RNCMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPY
PGVENSEIYDYLRQGNRLKQPADCLDGLYALMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVNMD
EGGGYPEPPGAAGGADPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA

Structural information

Protein Domains	Ig-like (27-128) Ig-like (139-222) Fibronectin (227-331) Fibronectin (336-428) Protein (536-807)
Interpro:	IPR003961 IPR007110 IPR013783 IPR003599 IPR011009 IPR000719 IPR017441 IPR001245 IPR008266 IPR020635
Prosite:	PS50853 PS50835 PS00107 PS50011 PS00109
Pfam:	PF00041 PF07714
CDD:	cd00063
PDB:	2C5D 4RA0
PDBsum:	2C5D 4RA0
MINT:	2735752
STRING:	ENSP00000301178;

Other Databases

GeneCards: AXL; Malacards: AXL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0001764	neuron migration	IEA	biological_process
GO:0001779	natural killer cell diffe rentiation	IEA	biological_process
GO:0001786	phosphatidylserine bindin g	IDA	molecular_function
GO:0001961	positive regulation of cy tokine-mediated signaling pathway	IDA	biological_process
GO:0001974	blood vessel remodeling	IEA	biological_process
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006909	phagocytosis	IDA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007283	spermatogenesis	IEA	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0021885	forebrain cell migration	IEA	biological_process
GO:0030168	platelet activation	IEA	biological_process
GO:0031668	cellular response to extr acellular stimulus	IEA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	IDA	biological_process
GO:0032720	negative regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0032825	positive regulation of na tural killer cell differe ntiation	IDA	biological_process
GO:0032940	secretion by cell	IEA	biological_process
GO:0034101	erythrocyte homeostasis	IEA	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IEA	biological_process
GO:0035457	cellular response to inte rferon-alpha	IDA	biological_process
GO:0042698	ovulation cycle	IEA	biological_process
GO:0043277	apoptotic cell clearance	IEA	biological_process
GO:0043491	protein kinase B signalin g	IEA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0044228	host cell surface	IDA	cellular_component
GO:0045087	innate immune response	IEA	biological_process
GO:0046718	viral entry into host cel l	IMP	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048469	cell maturation	IEP	biological_process
GO:0048549	positive regulation of pi nocytosis	IMP	biological_process
GO:0051250	negative regulation of ly mphocyte activation	IEA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IEA	biological_process
GO:0060068	vagina development	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071222	cellular response to lipo polysaccharide	IDA	biological_process
GO:0097028	dendritic cell differenti ation	IEP	biological_process
GO:2000669	negative regulation of de ndritic cell apoptotic pr ocess	IDA	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0001764	neuron migration	IEA	biological_process
GO:0001779	natural killer cell diffe rentiation	IEA	biological_process
GO:0001786	phosphatidylserine bindin g	IDA	molecular_function
GO:0001961	positive regulation of cy tokine-mediated signaling pathway	IDA	biological_process
GO:0001974	blood vessel remodeling	IEA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006909	phagocytosis	IEA	biological_process
GO:0006909	phagocytosis	IDA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007167	enzyme linked receptor pr otein signaling pathway	IEA	biological_process
GO:0007283	spermatogenesis	IEA	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0021885	forebrain cell migration	IEA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030168	platelet activation	IEA	biological_process
GO:0031668	cellular response to extr acellular stimulus	IEA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	IDA	biological_process
GO:0032720	negative regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0032825	positive regulation of na tural killer cell differe ntiation	IDA	biological_process
GO:0032940	secretion by cell	IEA	biological_process
GO:0034101	erythrocyte homeostasis	IEA	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IEA	biological_process
GO:0035457	cellular response to inte rferon-alpha	IDA	biological_process
GO:0042698	ovulation cycle	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043277	apoptotic cell clearance	IEA	biological_process
GO:0043491	protein kinase B signalin g	IEA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0044228	host cell surface	IDA	cellular_component
GO:0045087	innate immune response	IEA	biological_process
GO:0046718	viral entry into host cel l	IMP	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048469	cell maturation	IEP	biological_process
GO:0048549	positive regulation of pi nocytosis	IMP	biological_process
GO:0051250	negative regulation of ly mphocyte activation	IEA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IEA	biological_process
GO:0060068	vagina development	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071222	cellular response to lipo polysaccharide	IDA	biological_process
GO:0097028	dendritic cell differenti ation	IEP	biological_process
GO:2000669	negative regulation of de ndritic cell apoptotic pr ocess	IDA	biological_process
GO:0001786	phosphatidylserine bindin g	IDA	molecular_function
GO:0001961	positive regulation of cy tokine-mediated signaling pathway	IDA	biological_process
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006909	phagocytosis	IDA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0032689	negative regulation of in terferon-gamma production	IDA	biological_process
GO:0032825	positive regulation of na tural killer cell differe ntiation	IDA	biological_process
GO:0035457	cellular response to inte rferon-alpha	IDA	biological_process
GO:0044228	host cell surface	IDA	cellular_component
GO:0046718	viral entry into host cel l	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048469	cell maturation	IEP	biological_process
GO:0048549	positive regulation of pi nocytosis	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071222	cellular response to lipo polysaccharide	IDA	biological_process
GO:0097028	dendritic cell differenti ation	IEP	biological_process
GO:2000669	negative regulation of de ndritic cell apoptotic pr ocess	IDA	biological_process

KEGG pathways

hsa01521 EGFR tyrosine kinase inhibitor resistance

Diseases

Associated diseases	References
Endometrial cancer	PMID: 27764792
Endometriosis	PMID: 19055724
Male infertility	PMID: 24762434
Ovarian endometriosis	PMID: 12029073
Ovarian endometriosis	PMID: 12029073
Endometriosis	INFBASE19055724
Ovarian endometriosis	INFBASE12029073

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19055724	Endometrio sis			4 (3 endometrio tic tissues, 1 normal endometr ium sample )		MMP1 MMP2 MMP3 MMP10 MMP11 MMP14 AXL SHC1 ACTN4 PI3KCA p-AKT p-mTOR and p-ERK	Show abstract
12029073	Endometrio sis (ovari an)					Gas6 Axl Sky	Show abstract