Endometriosis Knowledgebase

Search Result

Gene id

5594

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MAPK1 Gene UCSC Ensembl

Aliases

ERK, ERK-2, ERK2, ERT1, MAPK2, P42MAPK, PRKM1, PRKM2, p38, p40, p41, p41mapk, p42-MAPK

Gene name

mitogen-activated protein kinase 1

Alternate names

mitogen-activated protein kinase 1, MAP kinase 1, MAP kinase 2, MAP kinase isoform p42, MAPK 2, extracellular signal-regulated kinase 2, mitogen-activated protein kinase 2, protein tyrosine kinase ERK2,

Gene location

22q11.22 (21867679: 21759656) Exons: 9 NC_000022.11

Gene summary(Entrez)

This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. [provided by RefSeq, Jan 2014]

OMIM

176948

Protein Summary

Protein general information

P28482

Name: Mitogen activated protein kinase 1 (MAP kinase 1) (MAPK 1) (EC 2.7.11.24) (ERT1) (Extracellular signal regulated kinase 2) (ERK 2) (MAP kinase isoform p42) (p42 MAPK) (Mitogen activated protein kinase 2) (MAP kinase 2) (MAPK 2)

Length: 360 Mass: 41,390

Sequence

MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKIL
LRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDL
KPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNR
PIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Structural information

Protein Domains	Protein (25-313)
Motifs	TXY (185-187) Cytoplasmic retention(318-322) Nuclear translocation(327-333)
Interpro:	IPR011009 IPR003527 IPR008349 IPR000719 IPR017441 IPR008271
Prosite:	PS01351 PS00107 PS50011 PS00108
Pfam:	PF00069
PDB:	1PME 1TVO 1WZY 2OJG 2OJI 2OJJ 2Y9Q 3D42 3D44 3I5Z 3I60 3SA0 3TEI 3W55 4FMQ 4FUX 4FUY 4FV0 4FV1 4FV2 4FV3 4FV4 4FV5 4FV6 4FV7 4FV8 4FV9 4G6N 4G6O 4H3P 4H3Q 4IZ5 4IZ7 4IZA 4N0S 4NIF 4O6E 4QP1 4QP2 4QP3 4QP4 4QP6 4QP7 4QP8 4QP9 4QPA 4QTA 4QTE 4XJ0 4ZXT 4ZZM
PDBsum:	1PME 1TVO 1WZY 2OJG 2OJI 2OJJ 2Y9Q 3D42 3D44 3I5Z 3I60 3SA0 3TEI 3W55 4FMQ 4FUX 4FUY 4FV0 4FV1 4FV2 4FV3 4FV4 4FV5 4FV6 4FV7 4FV8 4FV9 4G6N 4G6O 4H3P 4H3Q 4IZ5 4IZ7 4IZA 4N0S 4NIF 4O6E 4QP1 4QP2 4QP3 4QP4 4QP6 4QP7 4QP8 4QP9 4QPA 4QTA 4QTE 4XJ0 4ZXT 4ZZM
DIP:	519
MINT:	144006
STRING:	ENSP00000215832;

Other Databases

GeneCards: MAPK1; Malacards: MAPK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000187	activation of MAPK activi ty	TAS	biological_process
GO:0000189	MAPK import into nucleus	IEA	biological_process
GO:0001784	phosphotyrosine binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004707	MAP kinase activity	TAS	molecular_function
GO:0004707	MAP kinase activity	TAS	molecular_function
GO:0004707	MAP kinase activity	TAS	molecular_function
GO:0004707	MAP kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005770	late endosome	TAS	cellular_component
GO:0005794	Golgi apparatus	TAS	cellular_component
GO:0005815	microtubule organizing ce nter	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	TAS	cellular_component
GO:0005901	caveola	TAS	cellular_component
GO:0005925	focal adhesion	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0006950	response to stress	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	TAS	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008353	RNA polymerase II carboxy -terminal domain kinase a ctivity	ISS	molecular_function
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0009636	response to toxic substan ce	IEA	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IDA	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0015630	microtubule cytoskeleton	IDA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018107	peptidyl-threonine phosph orylation	ISS	biological_process
GO:0019233	sensory perception of pai n	IEA	biological_process
GO:0019858	cytosine metabolic proces s	IEA	biological_process
GO:0019902	phosphatase binding	IPI	molecular_function
GO:0030168	platelet activation	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0030424	axon	IEA	cellular_component
GO:0030878	thyroid gland development	IEA	biological_process
GO:0031143	pseudopodium	IEA	cellular_component
GO:0031435	mitogen-activated protein kinase kinase kinase bin ding	IEA	molecular_function
GO:0031647	regulation of protein sta bility	ISS	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IEA	biological_process
GO:0032212	positive regulation of te lomere maintenance via te lomerase	IMP	biological_process
GO:0032839	dendrite cytoplasm	IEA	cellular_component
GO:0032872	regulation of stress-acti vated MAPK cascade	TAS	biological_process
GO:0033598	mammary gland epithelial cell proliferation	IEA	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0038127	ERBB signaling pathway	IDA	biological_process
GO:0042473	outer ear morphogenesis	IEA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043204	perikaryon	IEA	cellular_component
GO:0043234	protein complex	IEA	cellular_component
GO:0043330	response to exogenous dsR NA	IEA	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0045596	negative regulation of ce ll differentiation	IEA	biological_process
GO:0045727	positive regulation of tr anslation	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0048538	thymus development	IEA	biological_process
GO:0050852	T cell receptor signaling pathway	IEA	biological_process
GO:0050853	B cell receptor signaling pathway	IEA	biological_process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	TAS	biological_process
GO:0051493	regulation of cytoskeleto n organization	TAS	biological_process
GO:0051973	positive regulation of te lomerase activity	IMP	biological_process
GO:0060020	Bergmann glial cell diffe rentiation	IEA	biological_process
GO:0060291	long-term synaptic potent iation	IEA	biological_process
GO:0060324	face development	IEA	biological_process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	TAS	biological_process
GO:0060425	lung morphogenesis	IEA	biological_process
GO:0060440	trachea formation	IEA	biological_process
GO:0060716	labyrinthine layer blood vessel development	IEA	biological_process
GO:0061308	cardiac neural crest cell development involved in heart development	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070371	ERK1 and ERK2 cascade	IDA	biological_process
GO:0070371	ERK1 and ERK2 cascade	TAS	biological_process
GO:0070849	response to epidermal gro wth factor	IDA	biological_process
GO:0072584	caveolin-mediated endocyt osis	TAS	biological_process
GO:0072686	mitotic spindle	ISS	cellular_component
GO:0090170	regulation of Golgi inher itance	TAS	biological_process
GO:0097011	cellular response to gran ulocyte macrophage colony -stimulating factor stimu lus	IEA	biological_process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:1904355	positive regulation of te lomere capping	IMP	biological_process
GO:2000641	regulation of early endos ome to late endosome tran sport	TAS	biological_process
GO:0000165	MAPK cascade	IEA	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0000187	activation of MAPK activi ty	TAS	biological_process
GO:0000189	MAPK import into nucleus	IEA	biological_process
GO:0001784	phosphotyrosine binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004707	MAP kinase activity	IEA	molecular_function
GO:0004707	MAP kinase activity	IEA	molecular_function
GO:0004707	MAP kinase activity	IEA	molecular_function
GO:0004707	MAP kinase activity	TAS	molecular_function
GO:0004707	MAP kinase activity	TAS	molecular_function
GO:0004707	MAP kinase activity	TAS	molecular_function
GO:0004707	MAP kinase activity	TAS	molecular_function
GO:0004707	MAP kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0005654	nucleoplasm	IEA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005770	late endosome	TAS	cellular_component
GO:0005794	Golgi apparatus	TAS	cellular_component
GO:0005815	microtubule organizing ce nter	IEA	cellular_component
GO:0005819	spindle	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	TAS	cellular_component
GO:0005901	caveola	TAS	cellular_component
GO:0005925	focal adhesion	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0006950	response to stress	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	TAS	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008353	RNA polymerase II carboxy -terminal domain kinase a ctivity	IEA	molecular_function
GO:0008353	RNA polymerase II carboxy -terminal domain kinase a ctivity	ISS	molecular_function
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0009636	response to toxic substan ce	IEA	biological_process
GO:0009887	animal organ morphogenesi s	IEA	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IDA	biological_process
GO:0014032	neural crest cell develop ment	IEA	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0015630	microtubule cytoskeleton	IDA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0016301	kinase activity	IEA	molecular_function
GO:0016301	kinase activity	IEA	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IEA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018107	peptidyl-threonine phosph orylation	IEA	biological_process
GO:0018107	peptidyl-threonine phosph orylation	ISS	biological_process
GO:0019233	sensory perception of pai n	IEA	biological_process
GO:0019858	cytosine metabolic proces s	IEA	biological_process
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0019902	phosphatase binding	IPI	molecular_function
GO:0030168	platelet activation	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0030424	axon	IEA	cellular_component
GO:0030878	thyroid gland development	IEA	biological_process
GO:0031143	pseudopodium	IEA	cellular_component
GO:0031435	mitogen-activated protein kinase kinase kinase bin ding	IEA	molecular_function
GO:0031647	regulation of protein sta bility	ISS	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IEA	biological_process
GO:0032212	positive regulation of te lomere maintenance via te lomerase	IMP	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032839	dendrite cytoplasm	IEA	cellular_component
GO:0032872	regulation of stress-acti vated MAPK cascade	TAS	biological_process
GO:0033598	mammary gland epithelial cell proliferation	IEA	biological_process
GO:0035556	intracellular signal tran sduction	IEA	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0038127	ERBB signaling pathway	IDA	biological_process
GO:0042473	outer ear morphogenesis	IEA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043204	perikaryon	IEA	cellular_component
GO:0043234	protein complex	IEA	cellular_component
GO:0043330	response to exogenous dsR NA	IEA	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0045596	negative regulation of ce ll differentiation	IEA	biological_process
GO:0045727	positive regulation of tr anslation	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0048538	thymus development	IEA	biological_process
GO:0050852	T cell receptor signaling pathway	IEA	biological_process
GO:0050853	B cell receptor signaling pathway	IEA	biological_process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	TAS	biological_process
GO:0051493	regulation of cytoskeleto n organization	TAS	biological_process
GO:0051973	positive regulation of te lomerase activity	IMP	biological_process
GO:0060020	Bergmann glial cell diffe rentiation	IEA	biological_process
GO:0060291	long-term synaptic potent iation	IEA	biological_process
GO:0060324	face development	IEA	biological_process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	TAS	biological_process
GO:0060425	lung morphogenesis	IEA	biological_process
GO:0060440	trachea formation	IEA	biological_process
GO:0060716	labyrinthine layer blood vessel development	IEA	biological_process
GO:0061308	cardiac neural crest cell development involved in heart development	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070371	ERK1 and ERK2 cascade	IEA	biological_process
GO:0070371	ERK1 and ERK2 cascade	IDA	biological_process
GO:0070371	ERK1 and ERK2 cascade	TAS	biological_process
GO:0070849	response to epidermal gro wth factor	IDA	biological_process
GO:0071310	cellular response to orga nic substance	IEA	biological_process
GO:0072584	caveolin-mediated endocyt osis	TAS	biological_process
GO:0072686	mitotic spindle	ISS	cellular_component
GO:0090170	regulation of Golgi inher itance	TAS	biological_process
GO:0097011	cellular response to gran ulocyte macrophage colony -stimulating factor stimu lus	IEA	biological_process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:1904355	positive regulation of te lomere capping	IMP	biological_process
GO:2000641	regulation of early endos ome to late endosome tran sport	TAS	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000187	activation of MAPK activi ty	TAS	biological_process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004707	MAP kinase activity	TAS	molecular_function
GO:0004707	MAP kinase activity	TAS	molecular_function
GO:0004707	MAP kinase activity	TAS	molecular_function
GO:0004707	MAP kinase activity	TAS	molecular_function
GO:0004707	MAP kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005770	late endosome	TAS	cellular_component
GO:0005794	Golgi apparatus	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	TAS	cellular_component
GO:0005901	caveola	TAS	cellular_component
GO:0005925	focal adhesion	TAS	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0006950	response to stress	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	TAS	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0008353	RNA polymerase II carboxy -terminal domain kinase a ctivity	ISS	molecular_function
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IDA	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0015630	microtubule cytoskeleton	IDA	cellular_component
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018107	peptidyl-threonine phosph orylation	ISS	biological_process
GO:0019902	phosphatase binding	IPI	molecular_function
GO:0030168	platelet activation	TAS	biological_process
GO:0031647	regulation of protein sta bility	ISS	biological_process
GO:0032212	positive regulation of te lomere maintenance via te lomerase	IMP	biological_process
GO:0032872	regulation of stress-acti vated MAPK cascade	TAS	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0038127	ERBB signaling pathway	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	TAS	biological_process
GO:0051493	regulation of cytoskeleto n organization	TAS	biological_process
GO:0051973	positive regulation of te lomerase activity	IMP	biological_process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070371	ERK1 and ERK2 cascade	IDA	biological_process
GO:0070371	ERK1 and ERK2 cascade	TAS	biological_process
GO:0070849	response to epidermal gro wth factor	IDA	biological_process
GO:0072584	caveolin-mediated endocyt osis	TAS	biological_process
GO:0072686	mitotic spindle	ISS	cellular_component
GO:0090170	regulation of Golgi inher itance	TAS	biological_process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:1904355	positive regulation of te lomere capping	IMP	biological_process
GO:2000641	regulation of early endos ome to late endosome tran sport	TAS	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05206  MicroRNAs in cancer
hsa05205  Proteoglycans in cancer
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04510  Focal adhesion
hsa05152  Tuberculosis
PTHR24055:SF203  CCKR signaling map
hsa05161  Hepatitis B
hsa04062  Chemokine signaling pathway
hsa05224  Breast cancer
hsa05164  Influenza A
hsa04068  FoxO signaling pathway
hsa05145  Toxoplasmosis
hsa04810  Regulation of actin cytoskeleton
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05203  Viral carcinogenesis
hsa04210  Apoptosis
hsa04621  NOD-like receptor signaling pathway
hsa04659  Th17 cell differentiation
hsa04668  TNF signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05142  Chagas disease
hsa05215  Prostate cancer
hsa01522  Endocrine resistance
hsa04657  IL-17 signaling pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04380  Osteoclast differentiation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04024  cAMP signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04066  HIF-1 signaling pathway
hsa05160  Hepatitis C
hsa04722  Neurotrophin signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04360  Axon guidance
hsa04620  Toll-like receptor signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04371  Apelin signaling pathway
hsa04915  Estrogen signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05218  Melanoma
hsa05140  Leishmaniasis
hsa05220  Chronic myeloid leukemia
hsa05212  Pancreatic cancer
hsa01524  Platinum drug resistance
hsa04917  Prolactin signaling pathway
hsa05133  Pertussis
hsa05210  Colorectal cancer
hsa04012  ErbB signaling pathway
hsa04910  Insulin signaling pathway
hsa04150  mTOR signaling pathway
hsa04350  TGF-beta signaling pathway
hsa05010  Alzheimer's disease
hsa05230  Central carbon metabolism in cancer
hsa04520  Adherens junction
PTHR24055:SF203  CCKR signaling map
hsa05132  Salmonella infection
hsa04071  Sphingolipid signaling pathway
hsa04140  Autophagy - animal
hsa05034  Alcoholism
hsa05219  Bladder cancer
hsa05211  Renal cell carcinoma
hsa04914  Progesterone-mediated oocyte maturation
hsa04611  Platelet activation
hsa05231  Choline metabolism in cancer
hsa05214  Glioma
hsa05213  Endometrial cancer
hsa04540  Gap junction
hsa04921  Oxytocin signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04912  GnRH signaling pathway
hsa05223  Non-small cell lung cancer
hsa05221  Acute myeloid leukemia
hsa04916  Melanogenesis
hsa04114  Oocyte meiosis
hsa04726  Serotonergic synapse
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04725  Cholinergic synapse
hsa04662  B cell receptor signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04664  Fc epsilon RI signaling pathway
hsa05131  Shigellosis
hsa04930  Type II diabetes mellitus
hsa04270  Vascular smooth muscle contraction
hsa04730  Long-term depression
hsa04723  Retrograde endocannabinoid signaling
hsa05020  Prion diseases
hsa05216  Thyroid cancer
hsa04713  Circadian entrainment
hsa04320  Dorso-ventral axis formation
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04724  Glutamatergic synapse
hsa04720  Long-term potentiation
PTHR24055:SF203  CCKR signaling map
PTHR24055:SF203  CCKR signaling map
PTHR24055:SF203  CCKR signaling map

Diseases

Associated diseases	References
Asthenozoospermia	PMID: 21961242
Cancer	PMID: 19730683
Endometriosis	PMID: 25996258
Endometriosis	PMID: 9506747
Multiple sclerosis	PMID: 21833088
Endometriosis	INFBASE25996258
Spermatogenetic defects	PMID: 26209830
Spermatogenetic defects	PMID: 26209830
Varicocele	PMID: 26209830

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25996258	Endometrio sis			42 (30 women wi th ovarian endo metriosis, 12 w omen without EM S)		CD147 Bcl-2 ERK	Show abstract