Endometriosis Knowledgebase

Search Result

Gene id

5609

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MAP2K7 Gene UCSC Ensembl

Aliases

JNKK2, MAPKK7, MEK, MEK 7, MKK7, PRKMK7, SAPKK-4, SAPKK4

Gene name

mitogen-activated protein kinase kinase 7

Alternate names

dual specificity mitogen-activated protein kinase kinase 7, JNK-activating kinase 2, MAP kinase kinase 7, MAPK/ERK kinase 7, SAPK kinase 4, c-Jun N-terminal kinase kinase 2, stress-activated protein kinase kinase 4,

Gene location

19p13.2 (7903779: 7914482) Exons: 12 NC_000019.10

Gene summary(Entrez)

The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically activates MAPK8/JNK1 and MAPK9/JNK2, and this kinase itself is phosphorylated and activated by MAP kinase kinase kinases including MAP3K1/MEKK1, MAP3K2/MEKK2,MAP3K3/MEKK5, and MAP4K2/GCK. This kinase is involved in the signal transduction mediating the cell responses to proinflammatory cytokines, and environmental stresses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

OMIM

603014

Protein Summary

Protein general information

O14733

Name: Dual specificity mitogen activated protein kinase kinase 7 (MAP kinase kinase 7) (MAPKK 7) (EC 2.7.12.2) (JNK activating kinase 2) (MAPK/ERK kinase 7) (MEK 7) (Stress activated protein kinase kinase 4) (SAPK kinase 4) (SAPKK 4) (SAPKK4) (c Jun N terminal

Length: 419 Mass: 47,485

Tissue specificity: Ubiquitous; with highest level of expression in skeletal muscle. Isoform 3 is found at low levels in placenta, fetal liver, and skeletal muscle. {ECO

Sequence

MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSESSPQHPTPPARPRHML
GLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQ
MRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVA
IVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
IRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLL
EHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR

Structural information

Protein Domains	Protein (120-380)
Interpro:	IPR011009 IPR000719 IPR008271
Prosite:	PS50011 PS00108
Pfam:	PF00069
PDB:	2DYL 3WZU 4UX9 5B2K 5B2L 5B2M
PDBsum:	2DYL 3WZU 4UX9 5B2K 5B2L 5B2M
MINT:	1378223
STRING:	ENSP00000381066;

Other Databases

GeneCards: MAP2K7; Malacards: MAP2K7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000287	magnesium ion binding	IDA	molecular_function
GO:0004702	signal transducer, downst ream of receptor, with se rine/threonine kinase act ivity	IBA	molecular_function
GO:0004708	MAP kinase kinase activit y	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006915	apoptotic process	IEA	biological_process
GO:0006970	response to osmotic stres s	IDA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007254	JNK cascade	TAS	biological_process
GO:0007257	activation of JUN kinase activity	ISS	biological_process
GO:0008022	protein C-terminus bindin g	IEA	molecular_function
GO:0008545	JUN kinase kinase activit y	IEA	molecular_function
GO:0009408	response to heat	IDA	biological_process
GO:0009411	response to UV	IDA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019903	protein phosphatase bindi ng	ISS	molecular_function
GO:0031435	mitogen-activated protein kinase kinase kinase bin ding	IEA	molecular_function
GO:0032212	positive regulation of te lomere maintenance via te lomerase	IMP	biological_process
GO:0034612	response to tumor necrosi s factor	IDA	biological_process
GO:0035897	proteolysis in other orga nism	TAS	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0043525	positive regulation of ne uron apoptotic process	IEA	biological_process
GO:0051403	stress-activated MAPK cas cade	IDA	biological_process
GO:0051973	positive regulation of te lomerase activity	IMP	biological_process
GO:0072709	cellular response to sorb itol	IEA	biological_process
GO:1904355	positive regulation of te lomere capping	IMP	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0000287	magnesium ion binding	IDA	molecular_function
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004702	signal transducer, downst ream of receptor, with se rine/threonine kinase act ivity	IBA	molecular_function
GO:0004708	MAP kinase kinase activit y	IEA	molecular_function
GO:0004708	MAP kinase kinase activit y	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006970	response to osmotic stres s	IDA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007254	JNK cascade	IEA	biological_process
GO:0007254	JNK cascade	TAS	biological_process
GO:0007257	activation of JUN kinase activity	IEA	biological_process
GO:0007257	activation of JUN kinase activity	ISS	biological_process
GO:0008022	protein C-terminus bindin g	IEA	molecular_function
GO:0008545	JUN kinase kinase activit y	IEA	molecular_function
GO:0009408	response to heat	IDA	biological_process
GO:0009411	response to UV	IDA	biological_process
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019903	protein phosphatase bindi ng	ISS	molecular_function
GO:0031435	mitogen-activated protein kinase kinase kinase bin ding	IEA	molecular_function
GO:0032212	positive regulation of te lomere maintenance via te lomerase	IMP	biological_process
GO:0034612	response to tumor necrosi s factor	IDA	biological_process
GO:0035897	proteolysis in other orga nism	TAS	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0043525	positive regulation of ne uron apoptotic process	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0051403	stress-activated MAPK cas cade	IDA	biological_process
GO:0051973	positive regulation of te lomerase activity	IMP	biological_process
GO:0072709	cellular response to sorb itol	IEA	biological_process
GO:1904355	positive regulation of te lomere capping	IMP	biological_process
GO:0000287	magnesium ion binding	IDA	molecular_function
GO:0004702	signal transducer, downst ream of receptor, with se rine/threonine kinase act ivity	IBA	molecular_function
GO:0004708	MAP kinase kinase activit y	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006970	response to osmotic stres s	IDA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007254	JNK cascade	TAS	biological_process
GO:0007257	activation of JUN kinase activity	ISS	biological_process
GO:0009408	response to heat	IDA	biological_process
GO:0009411	response to UV	IDA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019903	protein phosphatase bindi ng	ISS	molecular_function
GO:0032212	positive regulation of te lomere maintenance via te lomerase	IMP	biological_process
GO:0034612	response to tumor necrosi s factor	IDA	biological_process
GO:0035897	proteolysis in other orga nism	TAS	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0051403	stress-activated MAPK cas cade	IDA	biological_process
GO:0051973	positive regulation of te lomerase activity	IMP	biological_process
GO:1904355	positive regulation of te lomere capping	IMP	biological_process

KEGG pathways

hsa04010  MAPK signaling pathway
hsa05169  Epstein-Barr virus infection
hsa05418  Fluid shear stress and atherosclerosis
hsa05164  Influenza A
hsa04668  TNF signaling pathway
hsa04380  Osteoclast differentiation
hsa04722  Neurotrophin signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04012  ErbB signaling pathway
hsa04912  GnRH signaling pathway
hsa04530  Tight junction
hsa04141  Protein processing in endoplasmic reticulum
hsa04664  Fc epsilon RI signaling pathway

Diseases

Associated diseases	References
Endometriosis	PMID: 15299092
Endometriosis	INFBASE15299092

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
15299092	Endometrio sis					PDGFRA PKC beta1 JAK1 Sprouty2 MKK7 COUP-TF2 PGE2EP	Show abstract