Endometriosis Knowledgebase

Search Result

Gene id

5617

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PRL Gene UCSC Ensembl

Aliases

GHA1

Gene name

prolactin

Alternate names

prolactin, decidual prolactin, growth hormone A1,

Gene location

6p22.3 (22302896: 22287243) Exons: 7 NC_000006.12

Gene summary(Entrez)

This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2011]

OMIM

176760

Protein Summary

Protein general information

P01236

Name: Prolactin (PRL)

Length: 227 Mass: 25,876

Sequence

MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHG
RGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQ
TKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNN
NC

Structural information

Interpro:	IPR009079 IPR001400 IPR018116
Prosite:	PS00266 PS00338
Pfam:	PF00103
PDB:	1RW5 2Q98 3D48 3EW3 3MZG 3N06 3N0P 3NCB 3NCC 3NCE 3NCF 3NPZ
PDBsum:	1RW5 2Q98 3D48 3EW3 3MZG 3N06 3N0P 3NCB 3NCC 3NCE 3NCF 3NPZ
DIP:	59635
STRING:	ENSP00000302150;

Other Databases

GeneCards: PRL; Malacards: PRL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005148	prolactin receptor bindin g	TAS	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007565	female pregnancy	NAS	biological_process
GO:0007595	lactation	IEA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0040014	regulation of multicellul ar organism growth	IEP	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	TAS	biological_process
GO:0005148	prolactin receptor bindin g	TAS	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007565	female pregnancy	NAS	biological_process
GO:0007595	lactation	IEA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0040014	regulation of multicellul ar organism growth	IEP	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	TAS	biological_process
GO:0005148	prolactin receptor bindin g	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007565	female pregnancy	NAS	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0040014	regulation of multicellul ar organism growth	IEP	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	TAS	biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04917  Prolactin signaling pathway

Diseases

Associated diseases	References
Azoospermia	PMID: 15203635
Cancer	PMID: 16214922
Ejaculatory dysfunction	PMID: 26817308
Endometrial cancer	PMID: 19491263
Endometriosis	PMID: 11383925
Female infertility	PMID: 23116354
Hyperandrogenism	PMID: 15589886
Implantation failure	PMID: 15218000
Juvenile arthritis	PMID: 12154211
Luteal phase defects (LPD)	PMID: 2022718
Male infertility	PMID: 686399
Peritoneal endometriosis	INFBASE26583603
Endometriosis (Peritoneal)	INFBASE26583603
Endometriosis associated infertility	INFBASE16906287
Endometriosis	INFBASE3656300
Obesity	PMID: 19851340
Oligoasthenoteratozoospermia	PMID: 23933342
Oligozoospermia	PMID: 3335260
Paget's disease	PMID: 21623375
Peritoneal endometriosis	PMID: 26583603
Polycystic ovary syndrome (PCOS)	PMID: 25359296
Poor sperm motility	PMID: 2619414
Primary or secondary amenorrhea	PMID: 2119170
Psychiatric disorders	PMID: 19086053
Rheumatoid arthritis	PMID: 17468404
Secondary amenorrhea	PMID: 2119170
Sertoli cell-only syndrome (SCOS)	PMID: 7589627
Systemic lupus erythematosus	PMID: 11721693
Unexplained infertility	PMID: 15218000

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
16906287	Endometrio sis	49 (18 had stag e I-II endometr iosis, 10 had s tage III-IV end ometriosis, 21 controls underg oing laparoscop y for tubal ste rilization)	Female infertility		Show abstract
9076428	Endometrio sis	70 endometrioti c patients with or without inf ertility	Female infertility	PRL	Show abstract
8655924	Endometrio sis			PRL	Show abstract
3656300	Endometrio sis	55 infertile wo men with endome triosis	Female infertility	PRL	Show abstract
11383925	Endometrio sis	41 (20 infertil e women with st age I or II end ometriosis, 14 fertile women w ithout endometr iosis, 7 fertil e women with en dometriosis)		PRL	Show abstract
11942880	Endometrio sis	14 patients wit h laparoscopica lly proven endo metriosis		Prolactin PRLR	Show abstract
26583603	Endometrio sis (Perit oneal)			CA-125 Prolactin	Show abstract