Endometriosis Knowledgebase

Search Result

Gene id

5618

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PRLR Gene UCSC Ensembl

Aliases

HPRL, MFAB, hPRLrI

Gene name

prolactin receptor

Alternate names

prolactin receptor, hPRL receptor, secreted prolactin binding protein,

Gene location

5p13.2 (35230588: 35048294) Exons: 15 NC_000005.10

Gene summary(Entrez)

This gene encodes a receptor for the anterior pituitary hormone, prolactin, and belongs to the type I cytokine receptor family. Prolactin-dependent signaling occurs as the result of ligand-induced dimerization of the prolactin receptor. Several alternatively spliced transcript variants encoding different membrane-bound and soluble isoforms have been described for this gene, which may function to modulate the endocrine and autocrine effects of prolactin in normal tissue and cancer. [provided by RefSeq, Feb 2011]

OMIM

176761

Protein Summary

Protein general information

P16471

Name: Prolactin receptor (PRL R)

Length: 622 Mass: 69,506

Tissue specificity: Expressed in breast, placenta, kidney, liver and pancreas. {ECO

Sequence

MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHEC
PDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIK
WSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQ
IPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD
FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFY
DPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATL
LNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLP
KQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSS
KCRLQLGGLDYLDPACFTHSFH

Structural information

Protein Domains	Fibronectin (27-128) Fibronectin (129-229)
Motifs	WSXWS motif(215-219) Box 1(267-275)
Interpro:	IPR003961 IPR015152 IPR013783 IPR003528 IPR033230
Prosite:	PS50853 PS01352
Pfam:	PF09067
CDD:	cd00063
PDB:	1BP3 2LFG 2N7I 3D48 3MZG 3N06 3N0P 3NCB 3NCC 3NCE 3NCF 4I18
PDBsum:	1BP3 2LFG 2N7I 3D48 3MZG 3N06 3N0P 3NCB 3NCC 3NCE 3NCF 4I18
DIP:	288
MINT:	268499
STRING:	ENSP00000371432;

Other Databases

GeneCards: PRLR; Malacards: PRLR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004925	prolactin receptor activi ty	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006694	steroid biosynthetic proc ess	NAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	NAS	biological_process
GO:0007171	activation of transmembra ne receptor protein tyros ine kinase activity	IDA	biological_process
GO:0007566	embryo implantation	TAS	biological_process
GO:0007595	lactation	NAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0017046	peptide hormone binding	IPI	molecular_function
GO:0030155	regulation of cell adhesi on	IEA	biological_process
GO:0030856	regulation of epithelial cell differentiation	IEA	biological_process
GO:0031904	endosome lumen	TAS	cellular_component
GO:0038161	prolactin signaling pathw ay	IEA	biological_process
GO:0042110	T cell activation	NAS	biological_process
GO:0042803	protein homodimerization activity	NAS	molecular_function
GO:0042977	activation of JAK2 kinase activity	NAS	biological_process
GO:0042978	ornithine decarboxylase a ctivator activity	NAS	molecular_function
GO:0043066	negative regulation of ap optotic process	NAS	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	TAS	biological_process
GO:0060644	mammary gland epithelial cell differentiation	IEA	biological_process
GO:0060736	prostate gland growth	IEA	biological_process
GO:0060749	mammary gland alveolus de velopment	IEA	biological_process
GO:0004896	cytokine receptor activit y	IEA	molecular_function
GO:0004925	prolactin receptor activi ty	IEA	molecular_function
GO:0004925	prolactin receptor activi ty	IEA	molecular_function
GO:0004925	prolactin receptor activi ty	NAS	molecular_function
GO:0004925	prolactin receptor activi ty	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006694	steroid biosynthetic proc ess	NAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	NAS	biological_process
GO:0007171	activation of transmembra ne receptor protein tyros ine kinase activity	IDA	biological_process
GO:0007259	JAK-STAT cascade	IEA	biological_process
GO:0007566	embryo implantation	TAS	biological_process
GO:0007595	lactation	IEA	biological_process
GO:0007595	lactation	NAS	biological_process
GO:0007595	lactation	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0017046	peptide hormone binding	IPI	molecular_function
GO:0030155	regulation of cell adhesi on	IEA	biological_process
GO:0030856	regulation of epithelial cell differentiation	IEA	biological_process
GO:0031904	endosome lumen	TAS	cellular_component
GO:0038161	prolactin signaling pathw ay	IEA	biological_process
GO:0038161	prolactin signaling pathw ay	IEA	biological_process
GO:0042110	T cell activation	NAS	biological_process
GO:0042803	protein homodimerization activity	NAS	molecular_function
GO:0042977	activation of JAK2 kinase activity	NAS	biological_process
GO:0042978	ornithine decarboxylase a ctivator activity	NAS	molecular_function
GO:0043066	negative regulation of ap optotic process	NAS	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	TAS	biological_process
GO:0060644	mammary gland epithelial cell differentiation	IEA	biological_process
GO:0060736	prostate gland growth	IEA	biological_process
GO:0060749	mammary gland alveolus de velopment	IEA	biological_process
GO:0061180	mammary gland epithelium development	IEA	biological_process
GO:0004925	prolactin receptor activi ty	NAS	molecular_function
GO:0004925	prolactin receptor activi ty	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006694	steroid biosynthetic proc ess	NAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	NAS	biological_process
GO:0007171	activation of transmembra ne receptor protein tyros ine kinase activity	IDA	biological_process
GO:0007566	embryo implantation	TAS	biological_process
GO:0007595	lactation	NAS	biological_process
GO:0007595	lactation	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0017046	peptide hormone binding	IPI	molecular_function
GO:0031904	endosome lumen	TAS	cellular_component
GO:0042110	T cell activation	NAS	biological_process
GO:0042803	protein homodimerization activity	NAS	molecular_function
GO:0042977	activation of JAK2 kinase activity	NAS	biological_process
GO:0042978	ornithine decarboxylase a ctivator activity	NAS	molecular_function
GO:0043066	negative regulation of ap optotic process	NAS	biological_process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	TAS	biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04917  Prolactin signaling pathway

Diseases

Associated diseases	References
Cancer	PMID: 15119991
Ejaculatory dysfunction	PMID: 26817308
Endometriosis	PMID: 11942880
Hyperprolactinemia	PMID: 24195502
Male infertility	PMID: 15120973
Endometriosis	INFBASE11942880
Oligomenorrhea	PMID: 24195502
Psychiatric disorders	PMID: 19086053
Recurrent miscarriage	PMID: 20716560
Systemic lupus erythematosus	PMID: 12559630

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
11942880	Endometrio sis			14 patients wit h laparoscopica lly proven endo metriosis		Prolactin PRLR	Show abstract