Endometriosis Knowledgebase

Search Result

Gene id

56729

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

RETN Gene UCSC Ensembl

Aliases

ADSF, FIZZ3, RETN1, RSTN, XCP1

Gene name

resistin

Alternate names

resistin, C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1, adipose tissue-specific secretory factor, c/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, cysteine-rich secreted protein A12-alpha-like 2, c,

Gene location

19p13.2 (7669085: 7670453) Exons: 4 NC_000019.10

Gene summary(Entrez)

This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2010]

OMIM

605565

Protein Summary

Protein general information

Q9HD89

Name: Resistin (Adipose tissue specific secretory factor) (ADSF) (C/EBP epsilon regulated myeloid specific secreted cysteine rich protein) (Cysteine rich secreted protein A12 alpha like 2) (Cysteine rich secreted protein FIZZ3)

Length: 108 Mass: 11,419

Tissue specificity: Expressed in white adipose tissue (at protein level) (PubMed

Sequence

MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCG
SACGSWDVRAETTCHCQCAGMDWTGARCCRVQP

Structural information

Interpro:	IPR009714
Pfam:	PF06954
PDB:	1LV6
PDBsum:	1LV6
STRING:	ENSP00000221515;

Other Databases

GeneCards: RETN; Malacards: RETN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005179	hormone activity	IBA	molecular_function
GO:0005615	extracellular space	IBA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0007568	aging	IEA	biological_process
GO:0008150	biological_process	ND	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0010714	positive regulation of co llagen metabolic process	IEA	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IEA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0045444	fat cell differentiation	IEA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0050806	positive regulation of sy naptic transmission	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:2000252	negative regulation of fe eding behavior	IEA	biological_process
GO:2000872	positive regulation of pr ogesterone secretion	IEA	biological_process
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	IBA	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0007568	aging	IEA	biological_process
GO:0008150	biological_process	ND	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0010714	positive regulation of co llagen metabolic process	IEA	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IEA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0045444	fat cell differentiation	IEA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0050806	positive regulation of sy naptic transmission	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:2000252	negative regulation of fe eding behavior	IEA	biological_process
GO:2000872	positive regulation of pr ogesterone secretion	IEA	biological_process
GO:0005179	hormone activity	IBA	molecular_function
GO:0005615	extracellular space	IBA	cellular_component
GO:0008150	biological_process	ND	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

Diseases

Associated diseases	References
Anorexia nervosa	PMID: 16921786
Atherosclerosis	PMID: 16313475
Autism	PMID: 19058789
Cancer	PMID: 19273568
Chronic kidney failure	PMID: 19578796
Defective endometrial receptivity	PMID: 25935494
Diabetes	PMID: 18498634
Endometriosis	PMID: 20455877
Glomerulonephritis	PMID: 19420105
Insulin resistance	PMID: 12213907
Metabolic syndrome	PMID: 19056482
Endometriosis	INFBASE20455877
Obesity	PMID: 11978666
Polycystic ovary syndrome (PCOS)	PMID: 16130192

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
20455877	Endometrio sis			84 (48 women wi th endometriosi s, 36 women wit hout endometrio sis)		Resistin	Show abstract