Endometriosis Knowledgebase

Search Result

Gene id

5715

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PSMD9 Gene UCSC Ensembl

Aliases

Rpn4, p27

Gene name

proteasome 26S subunit, non-ATPase 9

Alternate names

26S proteasome non-ATPase regulatory subunit 9, 26S proteasome regulatory subunit p27, homolog of rat Bridge 1, proteasome (prosome, macropain) 26S subunit, non-ATPase, 9, proteasome 26S non-ATPase regulatory subunit 9,

Gene location

12q24.31 (121888730: 121917864) Exons: 6 NC_000012.12

Gene summary(Entrez)

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, May 2012]

OMIM

603146

Protein Summary

Protein general information

O00233

Name: 26S proteasome non ATPase regulatory subunit 9 (26S proteasome regulatory subunit p27)

Length: 223 Mass: 24,682

Tissue specificity: Expressed in all tissues tested, highly expressed in liver and kidney.

Sequence

MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTA
RHNIICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAMSRKLGQSESQGPPRAFAKVNSISPGSPASI
AGLQVDDEIVEFGSVNTQNFQSLHNIGSVVQHSEGKPLNVTVIRRGEKHQLRLVPTRWAGKGLLGCNIIPLQR

Structural information

Protein Domains	PDZ. (108-195)
Interpro:	IPR001478
Pfam:	PF13180
MINT:	1435362
STRING:	ENSP00000440485;

Other Databases

GeneCards: PSMD9; Malacards: PSMD9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000209	protein polyubiquitinatio n	TAS	biological_process
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0003713	transcription coactivator activity	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005838	proteasome regulatory par ticle	NAS	cellular_component
GO:0006511	ubiquitin-dependent prote in catabolic process	NAS	biological_process
GO:0006521	regulation of cellular am ino acid metabolic proces s	TAS	biological_process
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological_process
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological_process
GO:0032024	positive regulation of in sulin secretion	ISS	biological_process
GO:0033209	tumor necrosis factor-med iated signaling pathway	TAS	biological_process
GO:0038061	NIK/NF-kappaB signaling	TAS	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043425	bHLH transcription factor binding	ISS	molecular_function
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0046676	negative regulation of in sulin secretion	ISS	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0051436	negative regulation of ub iquitin-protein ligase ac tivity involved in mitoti c cell cycle	TAS	biological_process
GO:0051437	positive regulation of ub iquitin-protein ligase ac tivity involved in regula tion of mitotic cell cycl e transition	TAS	biological_process
GO:0060071	Wnt signaling pathway, pl anar cell polarity pathwa y	TAS	biological_process
GO:0070682	proteasome regulatory par ticle assembly	IMP	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0008540	proteasome regulatory par ticle, base subcomplex	IDA	cellular_component
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000209	protein polyubiquitinatio n	TAS	biological_process
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0003713	transcription coactivator activity	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005838	proteasome regulatory par ticle	NAS	cellular_component
GO:0006511	ubiquitin-dependent prote in catabolic process	NAS	biological_process
GO:0006521	regulation of cellular am ino acid metabolic proces s	TAS	biological_process
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological_process
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological_process
GO:0032024	positive regulation of in sulin secretion	ISS	biological_process
GO:0033209	tumor necrosis factor-med iated signaling pathway	TAS	biological_process
GO:0038061	NIK/NF-kappaB signaling	TAS	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043425	bHLH transcription factor binding	ISS	molecular_function
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0046676	negative regulation of in sulin secretion	ISS	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0051436	negative regulation of ub iquitin-protein ligase ac tivity involved in mitoti c cell cycle	TAS	biological_process
GO:0051437	positive regulation of ub iquitin-protein ligase ac tivity involved in regula tion of mitotic cell cycl e transition	TAS	biological_process
GO:0060071	Wnt signaling pathway, pl anar cell polarity pathwa y	TAS	biological_process
GO:0070682	proteasome regulatory par ticle assembly	IMP	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0008540	proteasome regulatory par ticle, base subcomplex	IDA	cellular_component
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000209	protein polyubiquitinatio n	TAS	biological_process
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0003713	transcription coactivator activity	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005838	proteasome regulatory par ticle	NAS	cellular_component
GO:0006511	ubiquitin-dependent prote in catabolic process	NAS	biological_process
GO:0006521	regulation of cellular am ino acid metabolic proces s	TAS	biological_process
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological_process
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological_process
GO:0032024	positive regulation of in sulin secretion	ISS	biological_process
GO:0033209	tumor necrosis factor-med iated signaling pathway	TAS	biological_process
GO:0038061	NIK/NF-kappaB signaling	TAS	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043425	bHLH transcription factor binding	ISS	molecular_function
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0046676	negative regulation of in sulin secretion	ISS	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0051436	negative regulation of ub iquitin-protein ligase ac tivity involved in mitoti c cell cycle	TAS	biological_process
GO:0051437	positive regulation of ub iquitin-protein ligase ac tivity involved in regula tion of mitotic cell cycl e transition	TAS	biological_process
GO:0060071	Wnt signaling pathway, pl anar cell polarity pathwa y	TAS	biological_process
GO:0070682	proteasome regulatory par ticle assembly	IMP	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0008540	proteasome regulatory par ticle, base subcomplex	IDA	cellular_component

Diseases

Associated diseases	References
Depression	PMID: 18504423
Diabetes	PMID: 17516568
Endometriosis	PMID: 19493606
Endometriosis	INFBASE19493606
Polycystic ovary syndrome (PCOS)	PMID: 19631369
Premature ovarian failure ( POF)	PMID: 23665265

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19493606	Endometrio sis	p27 (V109G )	Brazili an	213 (104 patien ts, 109 control subjects)		p27	Show abstract