Endometriosis Knowledgebase

Search Result

Gene id

5716

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PSMD10 Gene UCSC Ensembl

Aliases

dJ889N15.2, p28, p28(GANK)

Gene name

proteasome 26S subunit, non-ATPase 10

Alternate names

26S proteasome non-ATPase regulatory subunit 10, 26S proteasome regulatory subunit p28, ankyrin repeat protein, gankyrin, hepatocellular carcinoma-associated protein p28-II, proteasome (prosome, macropain) 26S subunit, non-ATPase, 10,

Gene location

Xq22.3 (5339882: 5306936) Exons: 6 NC_000009.12

Gene summary(Entrez)

This gene encodes a subunit of the PA700/19S complex, which is the regulatory component of the 26S proteasome. The 26S proteosome complex is required for ubiquitin-dependent protein degradation. This protein is a non-ATPase subunit that may be involved in protein-protein interactions. Aberrant expression of this gene may paly a role in tumorigenesis. Two transcripts encoding different isoforms have been described. Pseudogenes have been identified on chromosomes 3 and 20.[provided by RefSeq, Mar 2011]

OMIM

300880

Protein Summary

Protein general information

O75832

Name: 26S proteasome non-ATPase regulatory subunit 10 (26S proteasome regulatory subunit p28) (Gankyrin) (p28(GANK))

Length: 226 Mass: 24,428

Tissue specificity: Tends to be up-regulated in cancer cells with RAS mutations, including lung cancers and adenocarconimas (at protein level). {ECO

Sequence

MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWS
PLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEATAMHRAAAKG
NLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVE
G

Structural information

Interpro:	IPR002110 IPR020683 IPR036770
Prosite:	PS50297 PS50088
Pfam:	PF00023 PF12796
CDD:	cd00204
PDB:	1QYM 1TR4 1UOH 4NIK 5VHF 5VHH 5VHI 5VHJ 5VHM 5VHN 5VHO 5VHP 5VHQ 5VHR
PDBsum:	1QYM 1TR4 1UOH 4NIK 5VHF 5VHH 5VHI 5VHJ 5VHM 5VHN 5VHO 5VHP 5VHQ 5VHR
DIP:	39026
MINT:
STRING:	ENSP00000217958;

Other Databases

GeneCards: PSMD10; Malacards: PSMD10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000209	protein polyubiquitinatio n	TAS	biological_process
GO:0000502	proteasome complex	IDA	cellular_component
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005838	proteasome regulatory par ticle	TAS	cellular_component
GO:0006521	regulation of cellular am ino acid metabolic proces s	TAS	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0007253	cytoplasmic sequestering of NF-kappaB	IDA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0030307	positive regulation of ce ll growth	IDA	biological_process
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological_process
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological_process
GO:0031398	positive regulation of pr otein ubiquitination	IMP	biological_process
GO:0032088	negative regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	TAS	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IDA	biological_process
GO:0033209	tumor necrosis factor-med iated signaling pathway	TAS	biological_process
GO:0038061	NIK/NF-kappaB signaling	TAS	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043409	negative regulation of MA PK cascade	IMP	biological_process
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0043518	negative regulation of DN A damage response, signal transduction by p53 clas s mediator	IDA	biological_process
GO:0045111	intermediate filament cyt oskeleton	IDA	cellular_component
GO:0045737	positive regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IDA	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0051436	negative regulation of ub iquitin-protein ligase ac tivity involved in mitoti c cell cycle	TAS	biological_process
GO:0051437	positive regulation of ub iquitin-protein ligase ac tivity involved in regula tion of mitotic cell cycl e transition	TAS	biological_process
GO:0060071	Wnt signaling pathway, pl anar cell polarity pathwa y	TAS	biological_process
GO:0070682	proteasome regulatory par ticle assembly	IMP	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0090201	negative regulation of re lease of cytochrome c fro m mitochondria	IMP	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0008540	proteasome regulatory par ticle, base subcomplex	IDA	cellular_component
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000209	protein polyubiquitinatio n	TAS	biological_process
GO:0000502	proteasome complex	IDA	cellular_component
GO:0000502	proteasome complex	TAS	cellular_component
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005838	proteasome regulatory par ticle	TAS	cellular_component
GO:0006521	regulation of cellular am ino acid metabolic proces s	TAS	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0007253	cytoplasmic sequestering of NF-kappaB	IDA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0030307	positive regulation of ce ll growth	IDA	biological_process
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological_process
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological_process
GO:0031398	positive regulation of pr otein ubiquitination	IMP	biological_process
GO:0032088	negative regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	TAS	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IDA	biological_process
GO:0033209	tumor necrosis factor-med iated signaling pathway	TAS	biological_process
GO:0038061	NIK/NF-kappaB signaling	TAS	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043409	negative regulation of MA PK cascade	IMP	biological_process
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0043518	negative regulation of DN A damage response, signal transduction by p53 clas s mediator	IDA	biological_process
GO:0045111	intermediate filament cyt oskeleton	IDA	cellular_component
GO:0045737	positive regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IDA	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0051436	negative regulation of ub iquitin-protein ligase ac tivity involved in mitoti c cell cycle	TAS	biological_process
GO:0051437	positive regulation of ub iquitin-protein ligase ac tivity involved in regula tion of mitotic cell cycl e transition	TAS	biological_process
GO:0060071	Wnt signaling pathway, pl anar cell polarity pathwa y	TAS	biological_process
GO:0070682	proteasome regulatory par ticle assembly	IMP	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0090201	negative regulation of re lease of cytochrome c fro m mitochondria	IMP	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0008540	proteasome regulatory par ticle, base subcomplex	IDA	cellular_component
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000209	protein polyubiquitinatio n	TAS	biological_process
GO:0000502	proteasome complex	IDA	cellular_component
GO:0000502	proteasome complex	TAS	cellular_component
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005838	proteasome regulatory par ticle	TAS	cellular_component
GO:0006521	regulation of cellular am ino acid metabolic proces s	TAS	biological_process
GO:0007253	cytoplasmic sequestering of NF-kappaB	IDA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0030307	positive regulation of ce ll growth	IDA	biological_process
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological_process
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological_process
GO:0031398	positive regulation of pr otein ubiquitination	IMP	biological_process
GO:0032088	negative regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	TAS	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IDA	biological_process
GO:0033209	tumor necrosis factor-med iated signaling pathway	TAS	biological_process
GO:0038061	NIK/NF-kappaB signaling	TAS	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043409	negative regulation of MA PK cascade	IMP	biological_process
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0043518	negative regulation of DN A damage response, signal transduction by p53 clas s mediator	IDA	biological_process
GO:0045111	intermediate filament cyt oskeleton	IDA	cellular_component
GO:0045737	positive regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IDA	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0051436	negative regulation of ub iquitin-protein ligase ac tivity involved in mitoti c cell cycle	TAS	biological_process
GO:0051437	positive regulation of ub iquitin-protein ligase ac tivity involved in regula tion of mitotic cell cycl e transition	TAS	biological_process
GO:0060071	Wnt signaling pathway, pl anar cell polarity pathwa y	TAS	biological_process
GO:0070682	proteasome regulatory par ticle assembly	IMP	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0090201	negative regulation of re lease of cytochrome c fro m mitochondria	IMP	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0008540	proteasome regulatory par ticle, base subcomplex	IDA	cellular_component

Diseases

Associated diseases	References
Endometriosis (ovarian)	PMID: 26193952
Endometriosis (ovarian)	PMID: 26333495
Ovarian endometriosis	INFBASE26333495
Ovarian endometriosis	INFBASE26193952
Endometriosis (ovarian)	INFBASE26193952
Ovarian endometriosis	PMID: 26333495

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26193952	Endometrio sis (ovari an)			36 (21 patients with ovarian e ndometriosis (p aired ectopic a nd eutopic endo metrium) and 1 5 patients with normal endomet rium)			Show abstract
26333495	Endometrio sis (ovari an)					GPER Gankyrin	Show abstract