Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 5732
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol PTGER2   Gene   UCSC   Ensembl
Aliases EP2
Gene name prostaglandin E receptor 2
Alternate names prostaglandin E2 receptor EP2 subtype, PGE receptor EP2 subtype, PGE2 receptor EP2 subtype, prostaglandin E receptor 2 (subtype EP2), 53kD, prostaglandin E receptor 2 (subtype EP2), 53kDa, prostanoid EP2 receptor,
Gene location 14q22.1 (52314297: 52328605)     Exons: 2     NC_000014.9
Gene summary(Entrez) This gene encodes a receptor for prostaglandin E2, a metabolite of arachidonic acid which has different biologic activities in a wide range of tissues. Mutations in this gene are associated with aspirin-induced susceptibility to asthma. [provided by RefSeq, Oct 2009]
OMIM 176804

Protein Summary

Protein general information P43116  

Name: Prostaglandin E2 receptor EP2 subtype (PGE receptor EP2 subtype) (PGE2 receptor EP2 subtype) (Prostanoid EP2 receptor)

Length: 358  Mass: 39,761

Tissue specificity: Placenta and lung.

Sequence MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELV
FTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSR
SGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRM
HRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
Structural information
Interpro:  IPR000276 IPR017452 IPR008365 IPR001923
Prosite:   PS00237 PS50262

Pfam:  
PF00001
STRING:   ENSP00000245457;
Other Databases GeneCards:  PTGER2;  Malacards:  PTGER2

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0004957 prostaglandin E receptor
activity
IEA molecular_function
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
TAS cellular_component
GO:0007186 G-protein coupled recepto
r signaling pathway
TAS biological_process
GO:0007189 adenylate cyclase-activat
ing G-protein coupled rec
eptor signaling pathway
ISS biological_process
GO:0032496 response to lipopolysacch
aride
IEA biological_process
GO:0032570 response to progesterone
IEA biological_process
GO:0042127 regulation of cell prolif
eration
IEA biological_process
GO:0071380 cellular response to pros
taglandin E stimulus
ISS biological_process
GO:0004871 signal transducer activit
y
IEA molecular_function
GO:0004930 G-protein coupled recepto
r activity
IEA molecular_function
GO:0004930 G-protein coupled recepto
r activity
IEA molecular_function
GO:0004957 prostaglandin E receptor
activity
IEA molecular_function
GO:0004957 prostaglandin E receptor
activity
IEA molecular_function
GO:0004957 prostaglandin E receptor
activity
TAS molecular_function
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
TAS cellular_component
GO:0007165 signal transduction
IEA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IEA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IEA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
TAS biological_process
GO:0007189 adenylate cyclase-activat
ing G-protein coupled rec
eptor signaling pathway
IEA biological_process
GO:0007189 adenylate cyclase-activat
ing G-protein coupled rec
eptor signaling pathway
ISS biological_process
GO:0016020 membrane
IEA cellular_component
GO:0016021 integral component of mem
brane
IEA cellular_component
GO:0016021 integral component of mem
brane
IEA cellular_component
GO:0032496 response to lipopolysacch
aride
IEA biological_process
GO:0032570 response to progesterone
IEA biological_process
GO:0042127 regulation of cell prolif
eration
IEA biological_process
GO:0071380 cellular response to pros
taglandin E stimulus
IEA biological_process
GO:0071380 cellular response to pros
taglandin E stimulus
ISS biological_process
GO:0004957 prostaglandin E receptor
activity
TAS molecular_function
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
TAS cellular_component
GO:0007186 G-protein coupled recepto
r signaling pathway
TAS biological_process
GO:0007189 adenylate cyclase-activat
ing G-protein coupled rec
eptor signaling pathway
ISS biological_process
GO:0071380 cellular response to pros
taglandin E stimulus
ISS biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04080  Neuroactive ligand-receptor interaction
hsa04024  cAMP signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04924  Renin secretion

Diseases

Associated diseases References
Alzheimer's disease PMID: 19141999
Asthma PMID: 17496729
Cancer PMID: 19789190
Connective tissue diseases PMID: 19527514
Endometriosis PMID: 2896174
Myocardial infarction PMID: 16879213
Endometriosis INFBASE19407222

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
19407222 Endometrio
sis


PTGER2
PTGER4
Show abstract