Endometriosis Knowledgebase

Search Result

Gene id

5732

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PTGER2 Gene UCSC Ensembl

Aliases

EP2

Gene name

prostaglandin E receptor 2

Alternate names

prostaglandin E2 receptor EP2 subtype, PGE receptor EP2 subtype, PGE2 receptor EP2 subtype, prostaglandin E receptor 2 (subtype EP2), 53kD, prostaglandin E receptor 2 (subtype EP2), 53kDa, prostanoid EP2 receptor,

Gene location

14q22.1 (52314297: 52328605) Exons: 2 NC_000014.9

Gene summary(Entrez)

This gene encodes a receptor for prostaglandin E2, a metabolite of arachidonic acid which has different biologic activities in a wide range of tissues. Mutations in this gene are associated with aspirin-induced susceptibility to asthma. [provided by RefSeq, Oct 2009]

OMIM

176804

Protein Summary

Protein general information

P43116

Name: Prostaglandin E2 receptor EP2 subtype (PGE receptor EP2 subtype) (PGE2 receptor EP2 subtype) (Prostanoid EP2 receptor)

Length: 358 Mass: 39,761

Tissue specificity: Placenta and lung.

Sequence

MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELV
FTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSR
SGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRM
HRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL

Structural information

Interpro:	IPR000276 IPR017452 IPR008365 IPR001923
Prosite:	PS00237 PS50262
Pfam:	PF00001
STRING:	ENSP00000245457;

Other Databases

GeneCards: PTGER2; Malacards: PTGER2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004957	prostaglandin E receptor activity	IEA	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	ISS	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032570	response to progesterone	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0071380	cellular response to pros taglandin E stimulus	ISS	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004957	prostaglandin E receptor activity	IEA	molecular_function
GO:0004957	prostaglandin E receptor activity	IEA	molecular_function
GO:0004957	prostaglandin E receptor activity	TAS	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007165	signal transduction	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	IEA	biological_process
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	ISS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032570	response to progesterone	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0071380	cellular response to pros taglandin E stimulus	IEA	biological_process
GO:0071380	cellular response to pros taglandin E stimulus	ISS	biological_process
GO:0004957	prostaglandin E receptor activity	TAS	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	ISS	biological_process
GO:0071380	cellular response to pros taglandin E stimulus	ISS	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04080  Neuroactive ligand-receptor interaction
hsa04024  cAMP signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04924  Renin secretion

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Asthma	PMID: 17496729
Cancer	PMID: 19789190
Connective tissue diseases	PMID: 19527514
Endometriosis	PMID: 2896174
Myocardial infarction	PMID: 16879213
Endometriosis	INFBASE19407222

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19407222	Endometrio sis					PTGER2 PTGER4	Show abstract