Endometriosis Knowledgebase

Search Result

Gene id

5733

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PTGER3 Gene UCSC Ensembl

Aliases

EP3, EP3-I, EP3-II, EP3-III, EP3-IV, EP3-VI, EP3e, PGE2-R

Gene name

prostaglandin E receptor 3

Alternate names

prostaglandin E2 receptor EP3 subtype, PGE receptor, EP3 subtype, PGE2 receptor EP3 subtype, prostaglandin E receotor EP3 subtype 3 isoform, prostaglandin E receptor 3 (subtype EP3), prostaglandin receptor (PGE-2), prostanoid EP3 receptor,

Gene location

1p31.1 (71047813: 70852352) Exons: 10 NC_000001.11

Gene summary(Entrez)

The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009]

OMIM

176806

Protein Summary

Protein general information

P43115

Name: Prostaglandin E2 receptor EP3 subtype (PGE receptor EP3 subtype) (PGE2 receptor EP3 subtype) (PGE2 R) (Prostanoid EP3 receptor)

Length: 390 Mass: 43,310

Tissue specificity: Expressed in small intestine, heart, pancreas, gastric fundic mucosa, mammary artery and pulmonary vessels. {ECO

Sequence

MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLLTGFVGNALAMLLVSR
SYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRWEHIDPSGRLCTFFGLTMTVFGLSSLFIASA
MAVERALAIRAPHWYASHMKTRATRAVLLGVWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNW
GNLFFASAFAFLGLLALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLP
CQCSSTLMWSDHLER

Structural information

Interpro:	IPR001481 IPR000276 IPR017452 IPR008365 IPR001244 IPR000265
Prosite:	PS50262
Pfam:	PF00001
STRING:	ENSP00000349003;

Other Databases

GeneCards: PTGER3; Malacards: PTGER3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	TAS	molecular_function
GO:0004957	prostaglandin E receptor activity	NAS	molecular_function
GO:0005635	nuclear envelope	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IEA	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0008219	cell death	TAS	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010700	negative regulation of no repinephrine secretion	IEA	biological_process
GO:0014827	intestine smooth muscle c ontraction	IEA	biological_process
GO:0014832	urinary bladder smooth mu scle contraction	IEA	biological_process
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0030522	intracellular receptor si gnaling pathway	IEA	biological_process
GO:0030818	negative regulation of cA MP biosynthetic process	IEA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IEA	biological_process
GO:0031526	brush border membrane	IEA	cellular_component
GO:0031622	positive regulation of fe ver generation	ISS	biological_process
GO:0031965	nuclear membrane	IEA	cellular_component
GO:0032355	response to estradiol	IEA	biological_process
GO:0032570	response to progesterone	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0045907	positive regulation of va soconstriction	IEA	biological_process
GO:0046010	positive regulation of ci rcadian sleep/wake cycle, non-REM sleep	IEA	biological_process
GO:0046676	negative regulation of in sulin secretion	IEA	biological_process
GO:0060137	maternal process involved in parturition	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071347	cellular response to inte rleukin-1	IEA	biological_process
GO:0090331	negative regulation of pl atelet aggregation	IEA	biological_process
GO:1901380	negative regulation of po tassium ion transmembrane transport	IEA	biological_process
GO:1902074	response to salt	IEA	biological_process
GO:1903170	negative regulation of ca lcium ion transmembrane t ransport	IEA	biological_process
GO:1903640	negative regulation of ga strin-induced gastric aci d secretion	IEA	biological_process
GO:1904320	positive regulation of sm ooth muscle contraction i nvolved in micturition	IEA	biological_process
GO:1904322	cellular response to fors kolin	IEA	biological_process
GO:1904325	positive regulation of in hibitory G-protein couple d receptor phosphorylatio n	IEA	biological_process
GO:1904326	negative regulation of ci rcadian sleep/wake cycle, wakefulness	IEA	biological_process
GO:1904330	positive regulation of my ofibroblast contraction	IEA	biological_process
GO:1904343	positive regulation of co lon smooth muscle contrac tion	IEA	biological_process
GO:1904346	positive regulation of ga stric mucosal blood circu lation	IEA	biological_process
GO:1990767	prostaglandin receptor in ternalization	IEA	biological_process
GO:1990769	proximal neuron projectio n	IEA	cellular_component
GO:2000391	positive regulation of ne utrophil extravasation	IEA	biological_process
GO:2000978	negative regulation of fo rebrain neuron differenti ation	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0002029	desensitization of G-prot ein coupled receptor prot ein signaling pathway	IEA	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	TAS	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004955	prostaglandin receptor ac tivity	IEA	molecular_function
GO:0004957	prostaglandin E receptor activity	IEA	molecular_function
GO:0004957	prostaglandin E receptor activity	IEA	molecular_function
GO:0004957	prostaglandin E receptor activity	TAS	molecular_function
GO:0004957	prostaglandin E receptor activity	NAS	molecular_function
GO:0005635	nuclear envelope	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IEA	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0008219	cell death	TAS	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010700	negative regulation of no repinephrine secretion	IEA	biological_process
GO:0010840	regulation of circadian s leep/wake cycle, wakefuln ess	IEA	biological_process
GO:0014061	regulation of norepinephr ine secretion	IEA	biological_process
GO:0014827	intestine smooth muscle c ontraction	IEA	biological_process
GO:0014832	urinary bladder smooth mu scle contraction	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	TAS	cellular_component
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0030522	intracellular receptor si gnaling pathway	IEA	biological_process
GO:0030818	negative regulation of cA MP biosynthetic process	IEA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IEA	biological_process
GO:0031526	brush border membrane	IEA	cellular_component
GO:0031622	positive regulation of fe ver generation	ISS	biological_process
GO:0031623	receptor internalization	IEA	biological_process
GO:0031965	nuclear membrane	IEA	cellular_component
GO:0032355	response to estradiol	IEA	biological_process
GO:0032570	response to progesterone	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0043005	neuron projection	IEA	cellular_component
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0045907	positive regulation of va soconstriction	IEA	biological_process
GO:0046010	positive regulation of ci rcadian sleep/wake cycle, non-REM sleep	IEA	biological_process
GO:0046676	negative regulation of in sulin secretion	IEA	biological_process
GO:0060137	maternal process involved in parturition	IEA	biological_process
GO:0060455	negative regulation of ga stric acid secretion	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071347	cellular response to inte rleukin-1	IEA	biological_process
GO:0090331	negative regulation of pl atelet aggregation	IEA	biological_process
GO:1901380	negative regulation of po tassium ion transmembrane transport	IEA	biological_process
GO:1902074	response to salt	IEA	biological_process
GO:1903170	negative regulation of ca lcium ion transmembrane t ransport	IEA	biological_process
GO:1903524	positive regulation of bl ood circulation	IEA	biological_process
GO:1903640	negative regulation of ga strin-induced gastric aci d secretion	IEA	biological_process
GO:1904320	positive regulation of sm ooth muscle contraction i nvolved in micturition	IEA	biological_process
GO:1904322	cellular response to fors kolin	IEA	biological_process
GO:1904325	positive regulation of in hibitory G-protein couple d receptor phosphorylatio n	IEA	biological_process
GO:1904326	negative regulation of ci rcadian sleep/wake cycle, wakefulness	IEA	biological_process
GO:1904330	positive regulation of my ofibroblast contraction	IEA	biological_process
GO:1904343	positive regulation of co lon smooth muscle contrac tion	IEA	biological_process
GO:1904346	positive regulation of ga stric mucosal blood circu lation	IEA	biological_process
GO:1990767	prostaglandin receptor in ternalization	IEA	biological_process
GO:1990769	proximal neuron projectio n	IEA	cellular_component
GO:2000391	positive regulation of ne utrophil extravasation	IEA	biological_process
GO:2000978	negative regulation of fo rebrain neuron differenti ation	IEA	biological_process
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	TAS	molecular_function
GO:0004957	prostaglandin E receptor activity	TAS	molecular_function
GO:0004957	prostaglandin E receptor activity	NAS	molecular_function
GO:0005635	nuclear envelope	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0008219	cell death	TAS	biological_process
GO:0016021	integral component of mem brane	TAS	cellular_component
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0031622	positive regulation of fe ver generation	ISS	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04080  Neuroactive ligand-receptor interaction
hsa04024  cAMP signaling pathway
hsa04020  Calcium signaling pathway
hsa04923  Regulation of lipolysis in adipocytes

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Asthma	PMID: 17496729
Cancer	PMID: 19064572
Diminished ovarian reserve (DOR)	PMID: 22355044
Endometriosis	PMID: 26240828
Ovarian endometriosis	INFBASE16815388
Endometriosis	INFBASE15299092
Ovarian endometriosis	PMID: 16815388
Ovarian endometriosis	PMID: 16815388

PubMed references

PMID	Condition	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26240828	Endometrio sis	108	108 (78 with en dometriosis, 30 healthy contro l subjects)	Female infertility	EP3 EP4 FP PGT MRP4	Show abstract
16815388	Endometrio sis (ovari an)			Female infertility	PDGFRA PKCbeta1 JAK1 HSP90A COUP-TF2 MOR 17betaHSD2 Sprouty2 and PGE(2)EP3	Show abstract
15299092	Endometrio sis			Female infertility	PDGFRA PKC beta1 JAK1 Sprouty2 MKK7 COUP-TF2 PGE2EP	Show abstract