Endometriosis Knowledgebase

Search Result

Gene id

5734

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PTGER4 Gene UCSC Ensembl

Aliases

EP4, EP4R

Gene name

prostaglandin E receptor 4

Alternate names

prostaglandin E2 receptor EP4 subtype, PGE receptor, EP4 subtype, PGE2 receptor EP4 subtype, prostaglandin E receptor 4 (subtype EP4), prostanoid EP4 receptor,

Gene location

5p13.1 (40679929: 40740931) Exons: 7 NC_000005.10

Gene summary(Entrez)

The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 induced expression of early growth response 1 (EGR1), regulate the level and stability of cyclooxygenase-2 mRNA, and lead to the phosphorylation of glycogen synthase kinase-3. Knockout studies in mice suggest that this receptor may be involved in the neonatal adaptation of circulatory system, osteoporosis, as well as initiation of skin immune responses. [provided by RefSeq, Jul 2008]

OMIM

601586

Protein Summary

Protein general information

P35408

Name: Prostaglandin E2 receptor EP4 subtype (PGE receptor EP4 subtype) (PGE2 receptor EP4 subtype) (Prostanoid EP4 receptor)

Length: 488 Mass: 53,119

Tissue specificity: High in intestine and in peripheral blood mononuclear cells; low in lung, kidney, thymus, uterus, vasculature and brain. Not found in liver, heart, retina oe skeletal muscle.

Sequence

MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCGLAVTDLLGTLLVSPV
TIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLAINHAYFYSHYVDKRLAGLTLFAVYASNVLF
CALPNMGLGSSRLQYPDTWCFIDWTTNVTAHAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGT
EQHHAAAAASVASRGHPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSGQHCSDSQRTSSAMSG
HSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPGMGLAQEDTTSLRTLRISETSDSSQGQDSES
VLLVDEAGGSGRAGPAPKGSSLQVTFPSETLNLSEKCI

Structural information

Interpro:	IPR000276 IPR017452 IPR001758 IPR008365 IPR001244
Prosite:	PS00237 PS50262
Pfam:	PF00001
DIP:	61099
STRING:	ENSP00000302846;

Other Databases

GeneCards: PTGER4; Malacards: PTGER4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002792	negative regulation of pe ptide secretion	IEA	biological_process
GO:0004957	prostaglandin E receptor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006955	immune response	IEP	biological_process
GO:0007188	adenylate cyclase-modulat ing G-protein coupled rec eptor signaling pathway	IDA	biological_process
GO:0007254	JNK cascade	ISS	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEP	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010727	negative regulation of hy drogen peroxide metabolic process	IEA	biological_process
GO:0010840	regulation of circadian s leep/wake cycle, wakefuln ess	IEA	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IEA	biological_process
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0030819	positive regulation of cA MP biosynthetic process	IEA	biological_process
GO:0031965	nuclear membrane	IEA	cellular_component
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032570	response to progesterone	IEA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IEA	biological_process
GO:0033624	negative regulation of in tegrin activation	IDA	biological_process
GO:0035810	positive regulation of ur ine volume	IEA	biological_process
GO:0035815	positive regulation of re nal sodium excretion	IEA	biological_process
GO:0042093	T-helper cell differentia tion	ISS	biological_process
GO:0042322	negative regulation of ci rcadian sleep/wake cycle, REM sleep	IEA	biological_process
GO:0042466	chemokinesis	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IEA	biological_process
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043200	response to amino acid	IEA	biological_process
GO:0044306	neuron projection terminu s	IEA	cellular_component
GO:0045669	positive regulation of os teoblast differentiation	IEA	biological_process
GO:0045780	positive regulation of bo ne resorption	IEA	biological_process
GO:0045785	positive regulation of ce ll adhesion	IEA	biological_process
GO:0046010	positive regulation of ci rcadian sleep/wake cycle, non-REM sleep	IEA	biological_process
GO:0050710	negative regulation of cy tokine secretion	ISS	biological_process
GO:0050712	negative regulation of in terleukin-1 alpha secreti on	IEA	biological_process
GO:0050715	positive regulation of cy tokine secretion	ISS	biological_process
GO:0050728	negative regulation of in flammatory response	IDA	biological_process
GO:0050729	positive regulation of in flammatory response	ISS	biological_process
GO:0051492	regulation of stress fibe r assembly	ISS	biological_process
GO:0051771	negative regulation of ni tric-oxide synthase biosy nthetic process	IEA	biological_process
GO:0060137	maternal process involved in parturition	IEA	biological_process
GO:0060348	bone development	ISS	biological_process
GO:0070257	positive regulation of mu cus secretion	IEA	biological_process
GO:0070371	ERK1 and ERK2 cascade	ISS	biological_process
GO:0071260	cellular response to mech anical stimulus	ISS	biological_process
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071347	cellular response to inte rleukin-1	IEA	biological_process
GO:0071380	cellular response to pros taglandin E stimulus	IEA	biological_process
GO:0090303	positive regulation of wo und healing	IEA	biological_process
GO:0097070	ductus arteriosus closure	IEA	biological_process
GO:1900127	positive regulation of hy aluronan biosynthetic pro cess	IEA	biological_process
GO:1902074	response to salt	IEA	biological_process
GO:1904336	negative regulation of du ctus arteriosus closure	IEA	biological_process
GO:1904348	negative regulation of sm all intestine smooth musc le contraction	IEA	biological_process
GO:1904364	positive regulation of ca lcitonin secretion	IEA	biological_process
GO:1904367	positive regulation of ch emokinesis	IEA	biological_process
GO:1904466	positive regulation of ma trix metallopeptidase sec retion	IEA	biological_process
GO:1904468	negative regulation of tu mor necrosis factor secre tion	IEA	biological_process
GO:1904471	negative regulation of en dothelin secretion	IEA	biological_process
GO:1904496	positive regulation of su bstance P secretion, neur otransmission	IEA	biological_process
GO:1990785	response to water-immersi on restraint stress	IEA	biological_process
GO:2000388	positive regulation of an tral ovarian follicle gro wth	IEA	biological_process
GO:2000391	positive regulation of ne utrophil extravasation	IEA	biological_process
GO:2000420	negative regulation of eo sinophil extravasation	IDA	biological_process
GO:2001181	positive regulation of in terleukin-10 secretion	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0002792	negative regulation of pe ptide secretion	IEA	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004955	prostaglandin receptor ac tivity	IEA	molecular_function
GO:0004957	prostaglandin E receptor activity	IEA	molecular_function
GO:0004957	prostaglandin E receptor activity	IEA	molecular_function
GO:0004957	prostaglandin E receptor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006955	immune response	IEP	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007188	adenylate cyclase-modulat ing G-protein coupled rec eptor signaling pathway	IDA	biological_process
GO:0007254	JNK cascade	ISS	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEP	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010727	negative regulation of hy drogen peroxide metabolic process	IEA	biological_process
GO:0010840	regulation of circadian s leep/wake cycle, wakefuln ess	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0030278	regulation of ossificatio n	IEA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IEA	biological_process
GO:0031965	nuclear membrane	IEA	cellular_component
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032570	response to progesterone	IEA	biological_process
GO:0032720	negative regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IEA	biological_process
GO:0033624	negative regulation of in tegrin activation	IDA	biological_process
GO:0034695	response to prostaglandin E	IEA	biological_process
GO:0035810	positive regulation of ur ine volume	IEA	biological_process
GO:0035815	positive regulation of re nal sodium excretion	IEA	biological_process
GO:0042093	T-helper cell differentia tion	IEA	biological_process
GO:0042093	T-helper cell differentia tion	ISS	biological_process
GO:0042322	negative regulation of ci rcadian sleep/wake cycle, REM sleep	IEA	biological_process
GO:0042466	chemokinesis	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IEA	biological_process
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043200	response to amino acid	IEA	biological_process
GO:0044306	neuron projection terminu s	IEA	cellular_component
GO:0045669	positive regulation of os teoblast differentiation	IEA	biological_process
GO:0045778	positive regulation of os sification	IEA	biological_process
GO:0045780	positive regulation of bo ne resorption	IEA	biological_process
GO:0045785	positive regulation of ce ll adhesion	IEA	biological_process
GO:0046010	positive regulation of ci rcadian sleep/wake cycle, non-REM sleep	IEA	biological_process
GO:0050710	negative regulation of cy tokine secretion	IEA	biological_process
GO:0050710	negative regulation of cy tokine secretion	ISS	biological_process
GO:0050712	negative regulation of in terleukin-1 alpha secreti on	IEA	biological_process
GO:0050714	positive regulation of pr otein secretion	IEA	biological_process
GO:0050715	positive regulation of cy tokine secretion	IEA	biological_process
GO:0050715	positive regulation of cy tokine secretion	ISS	biological_process
GO:0050728	negative regulation of in flammatory response	IEA	biological_process
GO:0050728	negative regulation of in flammatory response	IDA	biological_process
GO:0050729	positive regulation of in flammatory response	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	ISS	biological_process
GO:0051492	regulation of stress fibe r assembly	IEA	biological_process
GO:0051492	regulation of stress fibe r assembly	ISS	biological_process
GO:0051771	negative regulation of ni tric-oxide synthase biosy nthetic process	IEA	biological_process
GO:0060137	maternal process involved in parturition	IEA	biological_process
GO:0060348	bone development	ISS	biological_process
GO:0070257	positive regulation of mu cus secretion	IEA	biological_process
GO:0070371	ERK1 and ERK2 cascade	ISS	biological_process
GO:0070555	response to interleukin-1	IEA	biological_process
GO:0071260	cellular response to mech anical stimulus	IEA	biological_process
GO:0071260	cellular response to mech anical stimulus	ISS	biological_process
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071347	cellular response to inte rleukin-1	IEA	biological_process
GO:0071380	cellular response to pros taglandin E stimulus	IEA	biological_process
GO:0090303	positive regulation of wo und healing	IEA	biological_process
GO:0097070	ductus arteriosus closure	IEA	biological_process
GO:1900127	positive regulation of hy aluronan biosynthetic pro cess	IEA	biological_process
GO:1902074	response to salt	IEA	biological_process
GO:1904336	negative regulation of du ctus arteriosus closure	IEA	biological_process
GO:1904348	negative regulation of sm all intestine smooth musc le contraction	IEA	biological_process
GO:1904364	positive regulation of ca lcitonin secretion	IEA	biological_process
GO:1904367	positive regulation of ch emokinesis	IEA	biological_process
GO:1904460	positive regulation of su bstance P secretion	IEA	biological_process
GO:1904466	positive regulation of ma trix metallopeptidase sec retion	IEA	biological_process
GO:1904468	negative regulation of tu mor necrosis factor secre tion	IEA	biological_process
GO:1904471	negative regulation of en dothelin secretion	IEA	biological_process
GO:1904496	positive regulation of su bstance P secretion, neur otransmission	IEA	biological_process
GO:1990785	response to water-immersi on restraint stress	IEA	biological_process
GO:2000386	positive regulation of ov arian follicle developmen t	IEA	biological_process
GO:2000388	positive regulation of an tral ovarian follicle gro wth	IEA	biological_process
GO:2000391	positive regulation of ne utrophil extravasation	IEA	biological_process
GO:2000420	negative regulation of eo sinophil extravasation	IDA	biological_process
GO:2001181	positive regulation of in terleukin-10 secretion	IEA	biological_process
GO:0004957	prostaglandin E receptor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006955	immune response	IEP	biological_process
GO:0007188	adenylate cyclase-modulat ing G-protein coupled rec eptor signaling pathway	IDA	biological_process
GO:0007254	JNK cascade	ISS	biological_process
GO:0009612	response to mechanical st imulus	IEP	biological_process
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0033624	negative regulation of in tegrin activation	IDA	biological_process
GO:0042093	T-helper cell differentia tion	ISS	biological_process
GO:0050710	negative regulation of cy tokine secretion	ISS	biological_process
GO:0050715	positive regulation of cy tokine secretion	ISS	biological_process
GO:0050728	negative regulation of in flammatory response	IDA	biological_process
GO:0050729	positive regulation of in flammatory response	ISS	biological_process
GO:0051492	regulation of stress fibe r assembly	ISS	biological_process
GO:0060348	bone development	ISS	biological_process
GO:0070371	ERK1 and ERK2 cascade	ISS	biological_process
GO:0071260	cellular response to mech anical stimulus	ISS	biological_process
GO:2000420	negative regulation of eo sinophil extravasation	IDA	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04080  Neuroactive ligand-receptor interaction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04924  Renin secretion

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Asthma	PMID: 17496729
Endometriosis	PMID: 26240828
Endometriosis	PMID: 19407222
Multiple sclerosis	PMID: 19879194
Endometriosis	INFBASE26240828

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26240828	Endometrio sis		108	108 (78 with en dometriosis, 30 healthy contro l subjects)	Female infertility	EP3 EP4 FP PGT MRP4	Show abstract
19407222	Endometrio sis					PTGER2 PTGER4	Show abstract