Endometriosis Knowledgebase

Search Result

Gene id

5737

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PTGFR Gene UCSC Ensembl

Aliases

Gene name

prostaglandin F receptor

Alternate names

prostaglandin F2-alpha receptor, PGF receptor, PGF2 alpha receptor, prostaglandin receptor (2-alpha), prostanoid FP receptor,

Gene location

1p31.1 (78490973: 78540700) Exons: 7 NC_000001.11

Gene summary(Entrez)

The protein encoded by this gene is member of the G-protein coupled receptor family. This protein is a receptor for prostaglandin F2-alpha (PGF2-alpha), which is known to be a potent luteolytic agent, and may also be involved in modulating intraocular pressure and smooth muscle contraction in uterus. Knockout studies in mice suggest that the interaction of PGF2-alpha with this receptor may initiate parturition in ovarian luteal cells and thus induce luteolysis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

OMIM

600563

Protein Summary

Protein general information

P43088

Name: Prostaglandin F2 alpha receptor (PGF receptor) (PGF2 alpha receptor) (Prostanoid FP receptor)

Length: 359 Mass: 40,055

Tissue specificity: Eye. {ECO

Sequence

MSMNNSKQLVSPAAALLSNTTCQTENRLSVFFSVIFMTVGILSNSLAIAILMKAYQRFRQKSKASFLLLASGLVI
TDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGLCPLLLGSVMAIERCIGVTKPIFHSTKITSK
HVKMMLSGVCLFAVFIALLPILGHRDYKIQASRTWCFYNTEDIKDWEDRFYLLLFSFLGLLALGVSLLCNAITGI
TLLRVKFKSQQHRQGRSHHLEMVIQLLAIMCVSCICWSPFLVTMANIGINGNHSLETCETTLFALRMATWNQILD
PWVYILLRKAVLKNLYKLASQCCGVHVISLHIWELSSIKNSLKVAAISESPVAEKSAST

Structural information

Interpro:	IPR000276 IPR017452 IPR000141 IPR008365
Prosite:	PS00237 PS50262
Pfam:	PF00001
STRING:	ENSP00000359793;

Other Databases

GeneCards: PTGFR; Malacards: PTGFR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004958	prostaglandin F receptor activity	IDA	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007567	parturition	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0035584	calcium-mediated signalin g using intracellular cal cium source	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0071799	cellular response to pros taglandin D stimulus	IMP	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004958	prostaglandin F receptor activity	IEA	molecular_function
GO:0004958	prostaglandin F receptor activity	IDA	molecular_function
GO:0004958	prostaglandin F receptor activity	TAS	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007165	signal transduction	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007567	parturition	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0032355	response to estradiol	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0035584	calcium-mediated signalin g using intracellular cal cium source	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0071799	cellular response to pros taglandin D stimulus	IMP	biological_process
GO:0004958	prostaglandin F receptor activity	IDA	molecular_function
GO:0004958	prostaglandin F receptor activity	TAS	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007567	parturition	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0035584	calcium-mediated signalin g using intracellular cal cium source	IDA	biological_process
GO:0071799	cellular response to pros taglandin D stimulus	IMP	biological_process

KEGG pathways

hsa04080  Neuroactive ligand-receptor interaction
hsa04072  Phospholipase D signaling pathway
hsa04020  Calcium signaling pathway

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Asthma	PMID: 17496729
Endometriosis	PMID: 6208058
Endometriosis	PMID: 25446850
Glaucoma	PMID: 17582204
Endometriosis	INFBASE25446850

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25446850	Endometrio sis			57 (29 patients with ovarian endometriosis, 28 control heal thy women)	Female infertility	PGF2A AKR1B1 AKR1C3 PLA2G2A PTGS2/COX-2 ABCC4 and PTGFR PLA2G4A and HPGD	Show abstract
26240828	Endometrio sis		108	108 (78 with en dometriosis, 30 healthy contro l subjects)	Female infertility	EP3 EP4 FP PGT MRP4	Show abstract