Endometriosis Knowledgebase

Search Result

Gene id

5742

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PTGS1 Gene UCSC Ensembl

Aliases

COX1, COX3, PCOX1, PES-1, PGG/HS, PGHS-1, PGHS1, PHS1, PTGHS

Gene name

prostaglandin-endoperoxide synthase 1

Alternate names

prostaglandin G/H synthase 1, PGH synthase 1, cyclooxygenase-1, prostaglandin H2 synthase 1, prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase),

Gene location

9q33.2 (122369905: 122395702) Exons: 16 NC_000009.12

Gene summary(Entrez)

This is one of two genes encoding similar enzymes that catalyze the conversion of arachinodate to prostaglandin. The encoded protein regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. Based on its ability to function as both a cyclooxygenase and as a peroxidase, the encoded protein has been identified as a moonlighting protein. The protein may promote cell proliferation during tumor progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

OMIM

176805

Protein Summary

Protein general information

P23219

Name: Prostaglandin G/H synthase 1 (EC 1.14.99.1) (Cyclooxygenase 1) (COX 1) (Prostaglandin H2 synthase 1) (PGH synthase 1) (PGHS 1) (PHS 1) (Prostaglandin endoperoxide synthase 1)

Length: 599 Mass: 68,686

Sequence

MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPGLWT
WLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRI
LPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGH
GVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNR
IAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDV
IRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIG
APFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL

Structural information

Protein Domains	EGF-like. (31-69)
Interpro:	IPR029580 IPR000742 IPR010255 IPR019791
Prosite:	PS50026 PS50292
Pfam:	PF03098 PF00008
MINT:	4530066
STRING:	ENSP00000354612;

Other Databases

GeneCards: PTGS1; Malacards: PTGS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001516	prostaglandin biosyntheti c process	ISS	biological_process
GO:0001750	photoreceptor outer segme nt	IEA	cellular_component
GO:0004601	peroxidase activity	TAS	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	IDA	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	TAS	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005635	nuclear envelope	IEA	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0006629	lipid metabolic process	NAS	biological_process
GO:0006805	xenobiotic metabolic proc ess	TAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0007612	learning	IEA	biological_process
GO:0007613	memory	IEA	biological_process
GO:0008217	regulation of blood press ure	ISS	biological_process
GO:0008289	lipid binding	IEA	molecular_function
GO:0010243	response to organonitroge n compound	IEA	biological_process
GO:0010700	negative regulation of no repinephrine secretion	IEA	biological_process
GO:0019233	sensory perception of pai n	IEA	biological_process
GO:0019371	cyclooxygenase pathway	IDA	biological_process
GO:0019371	cyclooxygenase pathway	TAS	biological_process
GO:0020037	heme binding	IEA	molecular_function
GO:0032811	negative regulation of ep inephrine secretion	IEA	biological_process
GO:0035633	maintenance of permeabili ty of blood-brain barrier	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0043231	intracellular membrane-bo unded organelle	ISS	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0045907	positive regulation of va soconstriction	IEA	biological_process
GO:0045987	positive regulation of sm ooth muscle contraction	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0051213	dioxygenase activity	IEA	molecular_function
GO:0051412	response to corticosteron e	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070542	response to fatty acid	IEA	biological_process
GO:0098869	cellular oxidant detoxifi cation	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	ISS	biological_process
GO:0001516	prostaglandin biosyntheti c process	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	IEA	biological_process
GO:0001750	photoreceptor outer segme nt	IEA	cellular_component
GO:0004601	peroxidase activity	IEA	molecular_function
GO:0004601	peroxidase activity	IEA	molecular_function
GO:0004601	peroxidase activity	TAS	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	IEA	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	IEA	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	IDA	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	TAS	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	TAS	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005635	nuclear envelope	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006629	lipid metabolic process	NAS	biological_process
GO:0006631	fatty acid metabolic proc ess	IEA	biological_process
GO:0006633	fatty acid biosynthetic p rocess	IEA	biological_process
GO:0006693	prostaglandin metabolic p rocess	IEA	biological_process
GO:0006693	prostaglandin metabolic p rocess	IEA	biological_process
GO:0006805	xenobiotic metabolic proc ess	TAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0007612	learning	IEA	biological_process
GO:0007613	memory	IEA	biological_process
GO:0008217	regulation of blood press ure	IEA	biological_process
GO:0008217	regulation of blood press ure	IEA	biological_process
GO:0008217	regulation of blood press ure	ISS	biological_process
GO:0008289	lipid binding	IEA	molecular_function
GO:0010243	response to organonitroge n compound	IEA	biological_process
GO:0010700	negative regulation of no repinephrine secretion	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0019233	sensory perception of pai n	IEA	biological_process
GO:0019371	cyclooxygenase pathway	IEA	biological_process
GO:0019371	cyclooxygenase pathway	IDA	biological_process
GO:0019371	cyclooxygenase pathway	TAS	biological_process
GO:0020037	heme binding	IEA	molecular_function
GO:0031090	organelle membrane	IEA	cellular_component
GO:0032811	negative regulation of ep inephrine secretion	IEA	biological_process
GO:0035633	maintenance of permeabili ty of blood-brain barrier	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0043231	intracellular membrane-bo unded organelle	ISS	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0045907	positive regulation of va soconstriction	IEA	biological_process
GO:0045987	positive regulation of sm ooth muscle contraction	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0051213	dioxygenase activity	IEA	molecular_function
GO:0051412	response to corticosteron e	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070542	response to fatty acid	IEA	biological_process
GO:0098869	cellular oxidant detoxifi cation	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	ISS	biological_process
GO:0004601	peroxidase activity	TAS	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	IDA	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	TAS	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	TAS	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0006629	lipid metabolic process	NAS	biological_process
GO:0006805	xenobiotic metabolic proc ess	TAS	biological_process
GO:0008217	regulation of blood press ure	ISS	biological_process
GO:0019371	cyclooxygenase pathway	IDA	biological_process
GO:0019371	cyclooxygenase pathway	TAS	biological_process
GO:0043231	intracellular membrane-bo unded organelle	ISS	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa01100  Metabolic pathways
hsa04611  Platelet activation
hsa04923  Regulation of lipolysis in adipocytes
hsa04726  Serotonergic synapse
hsa00590  Arachidonic acid metabolism

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Asthenozoospermia	PMID: 23645088
Asthma	PMID: 16055872
Atherosclerosis	PMID: 15041270
Cancer	PMID: 19692168
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Endometriosis	PMID: 12468643
Metabolic syndrome	PMID: 19056482
Endometriosis	INFBASE12468643
Oligoasthenoteratozoospermia	PMID: 25906828
Schizophrenia	PMID: 16181776
Ulcerative colitis	PMID: 18705313
Varicocele	PMID: 22747653

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
12468643	Endometrio sis					COX-1 COX-2	Show abstract