Endometriosis Knowledgebase

Search Result

Gene id

5743

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PTGS2 Gene UCSC Ensembl

Aliases

COX-2, COX2, GRIPGHS, PGG/HS, PGHS-2, PHS-2, hCox-2

Gene name

prostaglandin-endoperoxide synthase 2

Alternate names

prostaglandin G/H synthase 2, PGH synthase 2, PHS II, cyclooxygenase 2, cyclooxygenase 2b, prostaglandin H2 synthase 2, prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase),

Gene location

1q31.1 (186680426: 186671811) Exons: 10 NC_000001.11

Gene summary(Entrez)

Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes the inducible isozyme. It is regulated by specific stimulatory events, suggesting that it is responsible for the prostanoid biosynthesis involved in inflammation and mitogenesis. [provided by RefSeq, Feb 2009]

OMIM

600262

SNPs

rs20417

Strand: -   Allele origin: unknown  Allele change: C/G   Mutation type: snp

NC_000001.10   g.186650321C>G
NC_000001.11   g.186681189C>G
NG_028206.2   g.4239G>C
NM_000963.3   c.-899G>C
NR_125801.1   n.536C>G

Protein Summary

Protein general information

P35354

Name: Prostaglandin G/H synthase 2 (EC 1.14.99.1) (Cyclooxygenase 2) (COX 2) (PHS II) (Prostaglandin H2 synthase 2) (PGH synthase 2) (PGHS 2) (Prostaglandin endoperoxide synthase 2)

Length: 604 Mass: 68,996

Sequence

MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVH
YILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLG
VKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLA
RQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQNRIAAEFNTLYHWHP
LLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRVAGGRNVPPAVQKVSQASIDQSRQMKYQSFN
EYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVI
CSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL

Structural information

Protein Domains	EGF-like. (18-55)
Interpro:	IPR029576 IPR000742 IPR010255 IPR019791
Prosite:	PS50026 PS50292
Pfam:	PF03098 PF00008
PDB:	1V0X 5F19 5F1A 5IKQ 5IKR 5IKT 5IKV 5KIR
PDBsum:	1V0X 5F19 5F1A 5IKQ 5IKR 5IKT 5IKV 5KIR
DIP:	28131
MINT:	203337
STRING:	ENSP00000356438;

Other Databases

GeneCards: PTGS2; Malacards: PTGS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001516	prostaglandin biosyntheti c process	ISS	biological_process
GO:0001516	prostaglandin biosyntheti c process	NAS	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0004601	peroxidase activity	NAS	molecular_function
GO:0004601	peroxidase activity	TAS	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	IDA	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	IDA	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005901	caveola	IEA	cellular_component
GO:0006693	prostaglandin metabolic p rocess	TAS	biological_process
GO:0006769	nicotinamide metabolic pr ocess	TAS	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0007566	embryo implantation	IEA	biological_process
GO:0007612	learning	IEA	biological_process
GO:0007613	memory	IEA	biological_process
GO:0008217	regulation of blood press ure	ISS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0008289	lipid binding	IEA	molecular_function
GO:0009750	response to fructose	IEA	biological_process
GO:0010042	response to manganese ion	IEA	biological_process
GO:0010226	response to lithium ion	IEA	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	ISS	biological_process
GO:0019233	sensory perception of pai n	IEA	biological_process
GO:0019371	cyclooxygenase pathway	IDA	biological_process
GO:0019371	cyclooxygenase pathway	TAS	biological_process
GO:0019372	lipoxygenase pathway	TAS	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0020037	heme binding	ISS	molecular_function
GO:0030282	bone mineralization	IEA	biological_process
GO:0030728	ovulation	IEA	biological_process
GO:0031394	positive regulation of pr ostaglandin biosynthetic process	NAS	biological_process
GO:0031622	positive regulation of fe ver generation	ISS	biological_process
GO:0031915	positive regulation of sy naptic plasticity	IEA	biological_process
GO:0032227	negative regulation of sy naptic transmission, dopa minergic	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0033280	response to vitamin D	IEA	biological_process
GO:0034612	response to tumor necrosi s factor	IEA	biological_process
GO:0034644	cellular response to UV	IEA	biological_process
GO:0035633	maintenance of permeabili ty of blood-brain barrier	IEA	biological_process
GO:0042346	positive regulation of NF -kappaB import into nucle us	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042633	hair cycle	IEA	biological_process
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0043005	neuron projection	IDA	cellular_component
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043234	protein complex	IEA	cellular_component
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	ISS	biological_process
GO:0045786	negative regulation of ce ll cycle	IEA	biological_process
GO:0045907	positive regulation of va soconstriction	IEA	biological_process
GO:0045986	negative regulation of sm ooth muscle contraction	IEA	biological_process
GO:0045987	positive regulation of sm ooth muscle contraction	IEA	biological_process
GO:0046697	decidualization	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0050473	arachidonate 15-lipoxygen ase activity	TAS	molecular_function
GO:0050727	regulation of inflammator y response	NAS	biological_process
GO:0050873	brown fat cell differenti ation	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051926	negative regulation of ca lcium ion transport	IEA	biological_process
GO:0051968	positive regulation of sy naptic transmission, glut amatergic	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0070542	response to fatty acid	IEA	biological_process
GO:0071260	cellular response to mech anical stimulus	IEA	biological_process
GO:0071318	cellular response to ATP	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEP	biological_process
GO:0071498	cellular response to flui d shear stress	IEA	biological_process
GO:0071636	positive regulation of tr ansforming growth factor beta production	ISS	biological_process
GO:0090050	positive regulation of ce ll migration involved in sprouting angiogenesis	ISS	biological_process
GO:0090271	positive regulation of fi broblast growth factor pr oduction	ISS	biological_process
GO:0090336	positive regulation of br own fat cell differentiat ion	ISS	biological_process
GO:0090362	positive regulation of pl atelet-derived growth fac tor production	ISS	biological_process
GO:0098869	cellular oxidant detoxifi cation	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	ISS	biological_process
GO:0001516	prostaglandin biosyntheti c process	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	NAS	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0004601	peroxidase activity	IEA	molecular_function
GO:0004601	peroxidase activity	IEA	molecular_function
GO:0004601	peroxidase activity	NAS	molecular_function
GO:0004601	peroxidase activity	TAS	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	IEA	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	IEA	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	IEA	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	IDA	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	IDA	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005901	caveola	IEA	cellular_component
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006631	fatty acid metabolic proc ess	IEA	biological_process
GO:0006633	fatty acid biosynthetic p rocess	IEA	biological_process
GO:0006693	prostaglandin metabolic p rocess	IEA	biological_process
GO:0006693	prostaglandin metabolic p rocess	TAS	biological_process
GO:0006769	nicotinamide metabolic pr ocess	TAS	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0007566	embryo implantation	IEA	biological_process
GO:0007612	learning	IEA	biological_process
GO:0007613	memory	IEA	biological_process
GO:0008217	regulation of blood press ure	IEA	biological_process
GO:0008217	regulation of blood press ure	IEA	biological_process
GO:0008217	regulation of blood press ure	ISS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0008289	lipid binding	IEA	molecular_function
GO:0009314	response to radiation	IEA	biological_process
GO:0009750	response to fructose	IEA	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010042	response to manganese ion	IEA	biological_process
GO:0010226	response to lithium ion	IEA	biological_process
GO:0010243	response to organonitroge n compound	IEA	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IEA	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	ISS	biological_process
GO:0010942	positive regulation of ce ll death	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0016702	oxidoreductase activity, acting on single donors w ith incorporation of mole cular oxygen, incorporati on of two atoms of oxygen	IEA	molecular_function
GO:0019233	sensory perception of pai n	IEA	biological_process
GO:0019371	cyclooxygenase pathway	IEA	biological_process
GO:0019371	cyclooxygenase pathway	IEA	biological_process
GO:0019371	cyclooxygenase pathway	IDA	biological_process
GO:0019371	cyclooxygenase pathway	TAS	biological_process
GO:0019372	lipoxygenase pathway	TAS	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0020037	heme binding	IEA	molecular_function
GO:0020037	heme binding	IEA	molecular_function
GO:0020037	heme binding	ISS	molecular_function
GO:0030282	bone mineralization	IEA	biological_process
GO:0030728	ovulation	IEA	biological_process
GO:0031090	organelle membrane	IEA	cellular_component
GO:0031394	positive regulation of pr ostaglandin biosynthetic process	NAS	biological_process
GO:0031622	positive regulation of fe ver generation	IEA	biological_process
GO:0031622	positive regulation of fe ver generation	ISS	biological_process
GO:0031915	positive regulation of sy naptic plasticity	IEA	biological_process
GO:0032227	negative regulation of sy naptic transmission, dopa minergic	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0033280	response to vitamin D	IEA	biological_process
GO:0034097	response to cytokine	IEA	biological_process
GO:0034612	response to tumor necrosi s factor	IEA	biological_process
GO:0034644	cellular response to UV	IEA	biological_process
GO:0035633	maintenance of permeabili ty of blood-brain barrier	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0042346	positive regulation of NF -kappaB import into nucle us	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042633	hair cycle	IEA	biological_process
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0043005	neuron projection	IEA	cellular_component
GO:0043005	neuron projection	IDA	cellular_component
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0043234	protein complex	IEA	cellular_component
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IEA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	ISS	biological_process
GO:0045786	negative regulation of ce ll cycle	IEA	biological_process
GO:0045907	positive regulation of va soconstriction	IEA	biological_process
GO:0045986	negative regulation of sm ooth muscle contraction	IEA	biological_process
GO:0045987	positive regulation of sm ooth muscle contraction	IEA	biological_process
GO:0046697	decidualization	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0050473	arachidonate 15-lipoxygen ase activity	TAS	molecular_function
GO:0050727	regulation of inflammator y response	NAS	biological_process
GO:0050873	brown fat cell differenti ation	IEA	biological_process
GO:0051213	dioxygenase activity	IEA	molecular_function
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051926	negative regulation of ca lcium ion transport	IEA	biological_process
GO:0051968	positive regulation of sy naptic transmission, glut amatergic	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0070542	response to fatty acid	IEA	biological_process
GO:0071260	cellular response to mech anical stimulus	IEA	biological_process
GO:0071318	cellular response to ATP	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEP	biological_process
GO:0071498	cellular response to flui d shear stress	IEA	biological_process
GO:0071636	positive regulation of tr ansforming growth factor beta production	IEA	biological_process
GO:0071636	positive regulation of tr ansforming growth factor beta production	ISS	biological_process
GO:0090050	positive regulation of ce ll migration involved in sprouting angiogenesis	IEA	biological_process
GO:0090050	positive regulation of ce ll migration involved in sprouting angiogenesis	ISS	biological_process
GO:0090271	positive regulation of fi broblast growth factor pr oduction	IEA	biological_process
GO:0090271	positive regulation of fi broblast growth factor pr oduction	ISS	biological_process
GO:0090336	positive regulation of br own fat cell differentiat ion	IEA	biological_process
GO:0090336	positive regulation of br own fat cell differentiat ion	ISS	biological_process
GO:0090362	positive regulation of pl atelet-derived growth fac tor production	IEA	biological_process
GO:0090362	positive regulation of pl atelet-derived growth fac tor production	ISS	biological_process
GO:0098869	cellular oxidant detoxifi cation	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	ISS	biological_process
GO:0001516	prostaglandin biosyntheti c process	NAS	biological_process
GO:0004601	peroxidase activity	NAS	molecular_function
GO:0004601	peroxidase activity	TAS	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	IDA	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	IDA	molecular_function
GO:0004666	prostaglandin-endoperoxid e synthase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006693	prostaglandin metabolic p rocess	TAS	biological_process
GO:0006769	nicotinamide metabolic pr ocess	TAS	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0008217	regulation of blood press ure	ISS	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	ISS	biological_process
GO:0019371	cyclooxygenase pathway	IDA	biological_process
GO:0019371	cyclooxygenase pathway	TAS	biological_process
GO:0019372	lipoxygenase pathway	TAS	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0020037	heme binding	ISS	molecular_function
GO:0031394	positive regulation of pr ostaglandin biosynthetic process	NAS	biological_process
GO:0031622	positive regulation of fe ver generation	ISS	biological_process
GO:0043005	neuron projection	IDA	cellular_component
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	ISS	biological_process
GO:0050473	arachidonate 15-lipoxygen ase activity	TAS	molecular_function
GO:0050727	regulation of inflammator y response	NAS	biological_process
GO:0071456	cellular response to hypo xia	IEP	biological_process
GO:0071636	positive regulation of tr ansforming growth factor beta production	ISS	biological_process
GO:0090050	positive regulation of ce ll migration involved in sprouting angiogenesis	ISS	biological_process
GO:0090271	positive regulation of fi broblast growth factor pr oduction	ISS	biological_process
GO:0090336	positive regulation of br own fat cell differentiat ion	ISS	biological_process
GO:0090362	positive regulation of pl atelet-derived growth fac tor production	ISS	biological_process

KEGG pathways

hsa01100  Metabolic pathways
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04668  TNF signaling pathway
hsa04657  IL-17 signaling pathway
hsa05140  Leishmaniasis
hsa05222  Small cell lung cancer
hsa04064  NF-kappa B signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04726  Serotonergic synapse
hsa04370  VEGF signaling pathway
hsa05204  Chemical carcinogenesis
hsa00590  Arachidonic acid metabolism
hsa04723  Retrograde endocannabinoid signaling

Diseases

Associated diseases	References
Adenomyosis	PMID: 19188819
Alzheimer's disease	PMID: 17234302
Amyotrophic lateral sclerosis (ALS)	PMID: 18608101
Asthenozoospermia	PMID: 24981555
Asthma	PMID: 14749922
Autism	PMID: 18579107
Breast cancer	PMID: 18819034
Cerebral palsy	PMID: 19238444
Cholangiocarcinoma	KEGG: H00046
Chronic kidney failure	PMID: 19578796
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Chronic periodontitis	PMID: 19236532
Connective tissue diseases	PMID: 19527514
Depression	PMID: 20034614
Diabetes	PMID: 19268562
Diminished�ovarian reserve (DOR)	PMID: 22906700, 22246450
Endometrial cancer	PMID: 24436266
Endometriosis	PMID: 14747187
Endometriosis	PMID: 18930197
Esophageal cancer	KEGG: H00017
Hearing Loss	PMID: 19898482
Hypertension	PMID: 15167446
Hypospermatogenesis	PMID: 20188355
Implantation failure	PMID: 20599859
Inflammatory bowel disease	PMID: 16273614
Leukocytospermia	PMID: 26227162
Metabolic syndrome	PMID: 19056482
Multiple sclerosis	PMID: 17373929
Ovarian endometriosis	INFBASE18053993
Endometriotic lesions	INFBASE16309818
Endometriosis	INFBASE11228229
Oligohydramnios	PMID: 18771989
Osteoarthritis	PMID: 16453284
Ovarian endometriosis	PMID: 18053993
Ovarian endometriosis	PMID: 18053993
Parkinson's disease	PMID: 17171651
Penile cancer	KEGG: H00025
Platelet aggregation	PMID: 16150050
Polycystic ovary syndrome (PCOS)	PMID: 23900753
Poor�ovarian�response (POR)	PMID: 25083184
Recurrent implantation failure (RIF)	PMID: 20599859
Repeated implantation failure (RIF)	PMID: 19815191
Rheumatoid arthritis	PMID: 16821264
Rheumatoid arthritis	PMID: 18381795
Sarcoidosis	PMID: 16840740
Schizophrenia	PMID: 16181776
Spermatogenetic defects	PMID: 17307169
Systemic lupus erythematosus	PMID: 16871410
Varicocele	PMID: 22747653
Vitiligo	PMID: 19004621

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21601196	Endometrio sis					IL-17F IL-8 COX2	Show abstract
24901401	Endometrio sis			39 cases of the ectopic endome trial tissues w ithin the fallo pian tubes		Cox-2 NF-KB VEGF	Show abstract
24423359	Endometrio sis			57 (21 endometr ial and 36 endo metriotic tissu e)		COX-2 COUP-TFII	Show abstract
24035605	Endometrio sis			74 (45 women wi th endometriosi s, 29 normal co ntrols)	Female infertility	Cox-2 mPGES-1 mPGES-2 cPGES and AKR-1C3	Show abstract
23239446	Endometrio sis					COX-2 PGE	Show abstract
14747187	Endometrio sis			136 samples of endometriotic t issue from 103 patients affect ed by endometri osis.			Show abstract
26153366	Endometrio sis	G-765C (rs20417) of the�COX-2	Brazili an	887 (365 women with endometrio sis (251 infert ile and 114 fer tile), 522 fert ile women witho ut endometriosi s)	Female infertility		Show abstract
26675577	Endometrio sis			40 (30 women wi th endometriosi s, 10 controls without endomet riosis)			Show abstract
26276091	Endometrio sis			90 (60 women wi th endometriosi s, 30 women wit hout endometrio sis (control gr oup))	Female infertility		Show abstract
26054111	Endometrio sis	G to A at -1195 locus in the promoter region of COX-2		560 (170 cases of endometriosi s, 150 cases of adenomyosis, 240 matched non -endometriosis and non-adenomy osis controls)			Show abstract
25446850	Endometrio sis			57 (29 patients with ovarian endometriosis, 28 control heal thy women)	Female infertility	PGF2A AKR1B1 AKR1C3 PLA2G2A PTGS2/COX-2 ABCC4 and PTGFR PLA2G4A and HPGD	Show abstract
25439837	Endometrio sis			36 (16 normal c ontrols, 20 wom en with endomet riosis)	Female infertility	MIF CD74 and COX-2	Show abstract
22608095	Endometrio sis			80 (60 women wi th endometriosi s (endometriosi s group) 20 wom en without endo metriosis (cont rol group))			Show abstract
22276910	Endometrio sis			100 (50 endomet riosis, 50 cont rols)		COX-2 BRAF NRAS CFL1 MAT2A SEPT9 ATAD3A CADM2 NAA15 and CCDC21	Show abstract
21613300	Endometrio sis			20 (10 women wi th endometriosi s, 10 control w omen)		COX-2 CDX1 SHP HIF-1	Show abstract
21145050	Endometrio sis			20 (12 women wi th endometriosi s, 8 control wo men)			Show abstract
21111772	Endometrio sis					PGE2 COX-2 MMP1 MMP2 MMP3 MMP7 MMP9 TIMP1 TIMP2 TIMP3 TIMP4	Show abstract
20677482	Endometrio sis					NF-kappaB COX-2 TNF-alpha	Show abstract
20567147	Endometrio sis						Show abstract
20537326	Endometrio sis			48 (28 study pa tients, 20 cont rols)		RAGE EN-RAGE COX-2	Show abstract
20068324	Endometrio sis			47 (26 patients with endometri osis, 21 patien ts with other b enign gynecolog ical conditions )			Show abstract
20047585	Endometrio sis			60 (40 patients with endometri osis, 20 patien ts did not have endometriosis)		COX-2 Leptin	Show abstract
19917472	Endometrio sis			60 endometriose s from differen t sites (ovaria n, uterine, and peritoneal)�			Show abstract
19647233	Endometrio sis					COX-2 PGE2	Show abstract
19299454	Endometrio sis			593 (196 cases with pathologic ally proved end ometriosis, 397 disease-free w omen as control subjects)		COX-2 MIF IL-6 IL-10 IL-1 beta	Show abstract
18048499	Endometrio sis			29 (14 women wi th endometriosi s, 8 controls, 7 women who und erwent hysterec tomy for uterin e fibroids)		COX-2 ER PR	Show abstract
18039779	Endometrio sis						Show abstract
17295901	Endometrio sis			28 patients wit h endometriosis		PGES COX-2	Show abstract
15979990	Endometrio sis			103 (71 endomet riomas (group 1 ), 32 peritonea l implants and or recto-vagina l nodules (grou p 2) of endomet riotic tissue f rom 85 patients submitted to c omplete laparos copic ablation of severe endom etriosis)			Show abstract
15871199	Endometrio sis			67 (30 patients with ovarian e ndometriosis, 1 0 with ovarian chocolate cysts and 27 normal controls)			Show abstract
15533352	Endometrio sis			80 (46 patients with endometri osis, 34 fertil e women who und erwent laparosc opic tubal liga tion or reversa l of tubal ster ilization)			Show abstract
15483103	Endometrio sis					IL-1beta COX-2	Show abstract
14998974	Endometrio sis			54 (39 endometr iosis patients, 15 control wom en)		IL-18 COX-2	Show abstract
14505259	Endometrio sis			13 women with r ectal and vagin al endometriosi s, scar endomet riosis and endo metriosis of th e omentum majus			Show abstract
12322896	Endometrio sis			28 premenopaus al women underg oing laparotomy or laparoscopi c surgery for b enign condition s			Show abstract
11228229	Endometrio sis			118 (35 patient s with endometr iosis diagnosed by laparoscopy , 33 patients w ith histologica lly confirmed a denomyosis and 50 female contr ols with normal fecundity)			Show abstract
27132422	Endometrio sis	COX-2�(-1195 A/G polymorphism)	Chinese	89 (32 EM patie nts with pain, 28 EM patients without pain, a nd 29 healthy c ontrols)			Show abstract
16309818	Endometrio sis			70 (20 peritone al endometriosi s, 19 ovarian e ndometriosis, 3 1 deep-infiltra ting endometrio sis )		COX-2	Show abstract
11605057	Endometrio sis					VEGF COX-2	Show abstract
18053993	Ovarian en dometriosi s			50 patients wit h ovarian endom etriotic cysts		Cox-2 VEGF	Show abstract
27567427	Endometrio sis					CRH Ucn �Ucn2 CRH-receptors (type-1 and type-2)	Show abstract
21601196	Endometrio sis					IL-17F IL-8 COX2	Show abstract