Endometriosis Knowledgebase

Search Result

Gene id

5747

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PTK2 Gene UCSC Ensembl

Aliases

FADK, FAK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK

Gene name

protein tyrosine kinase 2

Alternate names

focal adhesion kinase 1, FADK 1, FAK-related non-kinase polypeptide, PTK2 protein tyrosine kinase 2, focal adhesion kinase isoform FAK-Del33, focal adhesion kinase-related nonkinase, protein phosphatase 1 regulatory subunit 71,

Gene location

8q24.3 (141001312: 140658381) Exons: 40 NC_000008.11

Gene summary(Entrez)

This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene, but the full-length natures of only four of them have been determined. [provided by RefSeq, Oct 2015]

OMIM

600758

Protein Summary

Protein general information

Q05397

Name: Focal adhesion kinase 1 (FADK 1) (EC 2.7.10.2) (Focal adhesion kinase related nonkinase) (FRNK) (Protein phosphatase 1 regulatory subunit 71) (PPP1R71) (Protein tyrosine kinase 2) (p125FAK) (pp125FAK)

Length: 1052 Mass: 119,233

Tissue specificity: Detected in B and T-lymphocytes. Isoform 1 and isoform 6 are detected in lung fibroblasts (at protein level). Ubiquitous. {ECO

Sequence

MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSH
KVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQ
VKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQ
QTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPK
LANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALA
VAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLIL
YAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQ
LSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGS
HGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRW
LEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNE
GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLL
PASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR
PH

Structural information

Protein Domains	FERM. (35-355) Protein (422-680)
Interpro:	IPR019749 IPR014352 IPR019748 IPR000299 IPR005189 IPR011009 IPR011993 IPR000719 IPR017441 IPR001245 IPR008266 IPR020635 IPR029071
Prosite:	PS00661 PS50057 PS00107 PS50011 PS00109
Pfam:	PF00373 PF03623 PF07714
PDB:	1K04 1K05 1MP8 1OW6 1OW7 1OW8 2ETM 2IJM 3B71 3BZ3 3PXK 3S9O 4EBV 4EBW 4GU6 4GU9 4I4E 4I4F 4K8A 4K9Y 4KAB 4KAO 4NY0 4Q9S
PDBsum:	1K04 1K05 1MP8 1OW6 1OW7 1OW8 2ETM 2IJM 3B71 3BZ3 3PXK 3S9O 4EBV 4EBW 4GU6 4GU9 4I4E 4I4F 4K8A 4K9Y 4KAB 4KAO 4NY0 4Q9S
MINT:	92695
STRING:	ENSP00000341189;

Other Databases

GeneCards: PTK2; Malacards: PTK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000226	microtubule cytoskeleton organization	IEA	biological_process
GO:0001525	angiogenesis	TAS	biological_process
GO:0001570	vasculogenesis	IEA	biological_process
GO:0001725	stress fiber	IDA	cellular_component
GO:0001764	neuron migration	IEA	biological_process
GO:0001890	placenta development	TAS	biological_process
GO:0001932	regulation of protein pho sphorylation	IGI	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0003007	heart morphogenesis	TAS	biological_process
GO:0003779	actin binding	IDA	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	ISS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IDA	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IDA	molecular_function
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005102	receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005815	microtubule organizing ce nter	IEA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005938	cell cortex	IEA	cellular_component
GO:0006921	cellular component disass embly involved in executi on phase of apoptosis	TAS	biological_process
GO:0007172	signal complex assembly	IEA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	IBA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	TAS	biological_process
GO:0007229	integrin-mediated signali ng pathway	IDA	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	ISS	biological_process
GO:0008360	regulation of cell shape	IMP	biological_process
GO:0008360	regulation of cell shape	IMP	biological_process
GO:0008432	JUN kinase binding	IDA	molecular_function
GO:0009790	embryo development	TAS	biological_process
GO:0010594	regulation of endothelial cell migration	TAS	biological_process
GO:0010632	regulation of epithelial cell migration	IGI	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IMP	biological_process
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0021955	central nervous system ne uron axonogenesis	IEA	biological_process
GO:0022408	negative regulation of ce ll-cell adhesion	IDA	biological_process
GO:0030010	establishment of cell pol arity	TAS	biological_process
GO:0030027	lamellipodium	IEA	cellular_component
GO:0030198	extracellular matrix orga nization	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IBA	cellular_component
GO:0033628	regulation of cell adhesi on mediated by integrin	IDA	biological_process
GO:0038007	netrin-activated signalin g pathway	TAS	biological_process
GO:0038083	peptidyl-tyrosine autopho sphorylation	IBA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0040023	establishment of nucleus localization	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IMP	biological_process
GO:0042169	SH2 domain binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043087	regulation of GTPase acti vity	TAS	biological_process
GO:0043542	endothelial cell migratio n	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	TAS	biological_process
GO:0045087	innate immune response	IBA	biological_process
GO:0045667	regulation of osteoblast differentiation	IMP	biological_process
GO:0045860	positive regulation of pr otein kinase activity	IMP	biological_process
GO:0046621	negative regulation of or gan growth	IEA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048013	ephrin receptor signaling pathway	IDA	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0048870	cell motility	TAS	biological_process
GO:0050771	negative regulation of ax onogenesis	IEA	biological_process
GO:0051493	regulation of cytoskeleto n organization	TAS	biological_process
GO:0051893	regulation of focal adhes ion assembly	TAS	biological_process
GO:0051893	regulation of focal adhes ion assembly	TAS	biological_process
GO:0051893	regulation of focal adhes ion assembly	IGI	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IMP	biological_process
GO:0051964	negative regulation of sy napse assembly	IEA	biological_process
GO:0060396	growth hormone receptor s ignaling pathway	IDA	biological_process
GO:1900024	regulation of substrate a dhesion-dependent cell sp reading	IGI	biological_process
GO:2000060	positive regulation of pr otein ubiquitination invo lved in ubiquitin-depende nt protein catabolic proc ess	ISS	biological_process
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0000226	microtubule cytoskeleton organization	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001525	angiogenesis	TAS	biological_process
GO:0001568	blood vessel development	IEA	biological_process
GO:0001570	vasculogenesis	IEA	biological_process
GO:0001725	stress fiber	IDA	cellular_component
GO:0001764	neuron migration	IEA	biological_process
GO:0001890	placenta development	TAS	biological_process
GO:0001932	regulation of protein pho sphorylation	IGI	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0003007	heart morphogenesis	TAS	biological_process
GO:0003779	actin binding	IDA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	ISS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IEA	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IDA	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IDA	molecular_function
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005102	receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005815	microtubule organizing ce nter	IEA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005925	focal adhesion	IEA	cellular_component
GO:0005925	focal adhesion	IEA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005938	cell cortex	IEA	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006921	cellular component disass embly involved in executi on phase of apoptosis	TAS	biological_process
GO:0007172	signal complex assembly	IEA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	IBA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	TAS	biological_process
GO:0007229	integrin-mediated signali ng pathway	IDA	biological_process
GO:0007229	integrin-mediated signali ng pathway	TAS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	ISS	biological_process
GO:0008360	regulation of cell shape	IMP	biological_process
GO:0008360	regulation of cell shape	IMP	biological_process
GO:0008432	JUN kinase binding	IDA	molecular_function
GO:0009790	embryo development	TAS	biological_process
GO:0010594	regulation of endothelial cell migration	TAS	biological_process
GO:0010632	regulation of epithelial cell migration	IGI	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IMP	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0016740	transferase activity	IEA	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0021955	central nervous system ne uron axonogenesis	IEA	biological_process
GO:0022408	negative regulation of ce ll-cell adhesion	IDA	biological_process
GO:0030010	establishment of cell pol arity	TAS	biological_process
GO:0030027	lamellipodium	IEA	cellular_component
GO:0030054	cell junction	IEA	cellular_component
GO:0030198	extracellular matrix orga nization	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IBA	cellular_component
GO:0033628	regulation of cell adhesi on mediated by integrin	IDA	biological_process
GO:0038007	netrin-activated signalin g pathway	TAS	biological_process
GO:0038083	peptidyl-tyrosine autopho sphorylation	IBA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0040023	establishment of nucleus localization	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IMP	biological_process
GO:0042169	SH2 domain binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043087	regulation of GTPase acti vity	TAS	biological_process
GO:0043542	endothelial cell migratio n	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	TAS	biological_process
GO:0045087	innate immune response	IBA	biological_process
GO:0045667	regulation of osteoblast differentiation	IMP	biological_process
GO:0045860	positive regulation of pr otein kinase activity	IMP	biological_process
GO:0046621	negative regulation of or gan growth	IEA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048013	ephrin receptor signaling pathway	IDA	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0048870	cell motility	TAS	biological_process
GO:0050771	negative regulation of ax onogenesis	IEA	biological_process
GO:0051493	regulation of cytoskeleto n organization	TAS	biological_process
GO:0051893	regulation of focal adhes ion assembly	TAS	biological_process
GO:0051893	regulation of focal adhes ion assembly	TAS	biological_process
GO:0051893	regulation of focal adhes ion assembly	IGI	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IMP	biological_process
GO:0051964	negative regulation of sy napse assembly	IEA	biological_process
GO:0060396	growth hormone receptor s ignaling pathway	IDA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEA	biological_process
GO:1900024	regulation of substrate a dhesion-dependent cell sp reading	IGI	biological_process
GO:2000060	positive regulation of pr otein ubiquitination invo lved in ubiquitin-depende nt protein catabolic proc ess	IEA	biological_process
GO:2000060	positive regulation of pr otein ubiquitination invo lved in ubiquitin-depende nt protein catabolic proc ess	ISS	biological_process
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0001525	angiogenesis	TAS	biological_process
GO:0001725	stress fiber	IDA	cellular_component
GO:0001890	placenta development	TAS	biological_process
GO:0001932	regulation of protein pho sphorylation	IGI	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0003007	heart morphogenesis	TAS	biological_process
GO:0003779	actin binding	IDA	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	ISS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IDA	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IDA	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005102	receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006921	cellular component disass embly involved in executi on phase of apoptosis	TAS	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	IBA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	TAS	biological_process
GO:0007229	integrin-mediated signali ng pathway	IDA	biological_process
GO:0007229	integrin-mediated signali ng pathway	TAS	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	ISS	biological_process
GO:0008360	regulation of cell shape	IMP	biological_process
GO:0008360	regulation of cell shape	IMP	biological_process
GO:0008432	JUN kinase binding	IDA	molecular_function
GO:0009790	embryo development	TAS	biological_process
GO:0010594	regulation of endothelial cell migration	TAS	biological_process
GO:0010632	regulation of epithelial cell migration	IGI	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IMP	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0022408	negative regulation of ce ll-cell adhesion	IDA	biological_process
GO:0030010	establishment of cell pol arity	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IBA	cellular_component
GO:0033628	regulation of cell adhesi on mediated by integrin	IDA	biological_process
GO:0038007	netrin-activated signalin g pathway	TAS	biological_process
GO:0038083	peptidyl-tyrosine autopho sphorylation	IBA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0042127	regulation of cell prolif eration	IMP	biological_process
GO:0042169	SH2 domain binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043087	regulation of GTPase acti vity	TAS	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	TAS	biological_process
GO:0045087	innate immune response	IBA	biological_process
GO:0045667	regulation of osteoblast differentiation	IMP	biological_process
GO:0045860	positive regulation of pr otein kinase activity	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048013	ephrin receptor signaling pathway	IDA	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0048870	cell motility	TAS	biological_process
GO:0051493	regulation of cytoskeleto n organization	TAS	biological_process
GO:0051893	regulation of focal adhes ion assembly	TAS	biological_process
GO:0051893	regulation of focal adhes ion assembly	TAS	biological_process
GO:0051893	regulation of focal adhes ion assembly	IGI	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IMP	biological_process
GO:0060396	growth hormone receptor s ignaling pathway	IDA	biological_process
GO:1900024	regulation of substrate a dhesion-dependent cell sp reading	IGI	biological_process
GO:2000060	positive regulation of pr otein ubiquitination invo lved in ubiquitin-depende nt protein catabolic proc ess	ISS	biological_process
GO:2000811	negative regulation of an oikis	IMP	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05205  Proteoglycans in cancer
hsa04510  Focal adhesion
hsa05418  Fluid shear stress and atherosclerosis
hsa04062  Chemokine signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05202  Transcriptional misregulation in cancer
hsa01522  Endocrine resistance
hsa04360  Axon guidance
hsa05146  Amoebiasis
hsa05222  Small cell lung cancer
hsa04012  ErbB signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04370  VEGF signaling pathway
hsa05100  Bacterial invasion of epithelial cells

Diseases

Associated diseases	References
Cancer	PMID: 14578863
Multiple sclerosis	PMID: 21502966
Ovarian endometriosis	INFBASE18294638
Endometriosis	INFBASE17543958
Ovarian endometriosis	PMID: 18294638
Ovarian endometriosis	PMID: 18294638
Schizophrenia	PMID: 19736351

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17543958	Endometrio sis						Show abstract
18294638	Endometrio sis (ovari an)			61 (41 women wi th ovarian endo metriosis, 20 h ealthy women un dergoing surger y for benign in dications)		FAK	Show abstract