Endometriosis Knowledgebase

Search Result

Gene id

5764

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PTN Gene UCSC Ensembl

Aliases

HARP, HB-GAM, HBBM, HBGF-8, HBGF8, HBNF, HBNF-1, NEGF1, OSF-1

Gene name

pleiotrophin

Alternate names

pleiotrophin, heparin affin regulatory protein, heparin-binding brain mitogen, heparin-binding growth factor 8, heparin-binding growth-associated molecule, heparin-binding neurite outgrowth promoting factor, heparin-binding neurite outgrowth-promoting factor 1, ,

Gene location

7q33 (137343864: 137227340) Exons: 6 NC_000007.14

Gene summary(Entrez)

The protein encoded by this gene is a secreted heparin-binding growth factor. The protein has significant roles in cell growth and survival, cell migration, angiogenesis and tumorigenesis. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Oct 2016]

OMIM

162095

Protein Summary

Protein general information

P21246

Name: Pleiotrophin (PTN) (Heparin binding brain mitogen) (HBBM) (Heparin binding growth factor 8) (HBGF 8) (Heparin binding growth associated molecule) (HB GAM) (Heparin binding neurite outgrowth promoting factor 1) (HBNF 1) (Osteoblast specific factor 1) (OSF

Length: 168 Mass: 18,942

Tissue specificity: Osteoblast and brain.

Sequence

MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAE
CKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQ
AESKKKKKEGKKQEKMLD

Structural information

Interpro:	IPR000762 IPR020090 IPR020091 IPR020089 IPR020092
Prosite:	PS00619 PS00620
Pfam:	PF01091 PF05196
PDB:	2N6F
PDBsum:	2N6F
DIP:	5953
MINT:	1374580
STRING:	ENSP00000341170;

Other Databases

GeneCards: PTN; Malacards: PTN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001889	liver development	IEA	biological_process
GO:0004864	protein phosphatase inhib itor activity	TAS	molecular_function
GO:0005604	basement membrane	IEA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0007185	transmembrane receptor pr otein tyrosine phosphatas e signaling pathway	TAS	biological_process
GO:0007399	nervous system developmen t	TAS	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0007612	learning	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008201	heparin binding	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0008360	regulation of cell shape	IEA	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010811	positive regulation of ce ll-substrate adhesion	IEA	biological_process
GO:0010976	positive regulation of ne uron projection developme nt	IEA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016525	negative regulation of an giogenesis	IEA	biological_process
GO:0021510	spinal cord development	IEA	biological_process
GO:0021549	cerebellum development	IEA	biological_process
GO:0021794	thalamus development	IEA	biological_process
GO:0030282	bone mineralization	IEA	biological_process
GO:0030324	lung development	IEA	biological_process
GO:0030336	negative regulation of ce ll migration	IEA	biological_process
GO:0031594	neuromuscular junction	IEA	cellular_component
GO:0032355	response to estradiol	IEA	biological_process
GO:0032570	response to progesterone	IEA	biological_process
GO:0034644	cellular response to UV	IEA	biological_process
GO:0035373	chondroitin sulfate prote oglycan binding	IEA	molecular_function
GO:0036120	cellular response to plat elet-derived growth facto r stimulus	IEA	biological_process
GO:0038085	vascular endothelial grow th factor binding	IEA	molecular_function
GO:0042493	response to drug	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043086	negative regulation of ca talytic activity	IEA	biological_process
GO:0044849	estrous cycle	IEA	biological_process
GO:0045446	endothelial cell differen tiation	IEA	biological_process
GO:0045837	negative regulation of me mbrane potential	IEA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0050680	negative regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:0060221	retinal rod cell differen tiation	IEA	biological_process
GO:0060253	negative regulation of gl ial cell proliferation	IEA	biological_process
GO:0060291	long-term synaptic potent iation	IEA	biological_process
GO:0071305	cellular response to vita min D	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0072201	negative regulation of me senchymal cell proliferat ion	IEA	biological_process
GO:1904373	response to kainic acid	IEA	biological_process
GO:1904389	rod bipolar cell differen tiation	IEA	biological_process
GO:1904391	response to ciliary neuro trophic factor	IEA	biological_process
GO:1904395	positive regulation of sk eletal muscle acetylcholi ne-gated channel clusteri ng	IEA	biological_process
GO:1904397	negative regulation of ne uromuscular junction deve lopment	IEA	biological_process
GO:1904399	heparan sulfate binding	IEA	molecular_function
GO:1990089	response to nerve growth factor	IEA	biological_process
GO:2000347	positive regulation of he patocyte proliferation	IEA	biological_process
GO:0001503	ossification	IEA	biological_process
GO:0001889	liver development	IEA	biological_process
GO:0004864	protein phosphatase inhib itor activity	TAS	molecular_function
GO:0005539	glycosaminoglycan binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005604	basement membrane	IEA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0007185	transmembrane receptor pr otein tyrosine phosphatas e signaling pathway	TAS	biological_process
GO:0007399	nervous system developmen t	TAS	biological_process
GO:0007420	brain development	IEA	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0007612	learning	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008201	heparin binding	IEA	molecular_function
GO:0008201	heparin binding	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0008360	regulation of cell shape	IEA	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010811	positive regulation of ce ll-substrate adhesion	IEA	biological_process
GO:0010976	positive regulation of ne uron projection developme nt	IEA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016525	negative regulation of an giogenesis	IEA	biological_process
GO:0021510	spinal cord development	IEA	biological_process
GO:0021549	cerebellum development	IEA	biological_process
GO:0021794	thalamus development	IEA	biological_process
GO:0030282	bone mineralization	IEA	biological_process
GO:0030324	lung development	IEA	biological_process
GO:0030336	negative regulation of ce ll migration	IEA	biological_process
GO:0030902	hindbrain development	IEA	biological_process
GO:0031594	neuromuscular junction	IEA	cellular_component
GO:0032355	response to estradiol	IEA	biological_process
GO:0032570	response to progesterone	IEA	biological_process
GO:0034644	cellular response to UV	IEA	biological_process
GO:0035373	chondroitin sulfate prote oglycan binding	IEA	molecular_function
GO:0036120	cellular response to plat elet-derived growth facto r stimulus	IEA	biological_process
GO:0038085	vascular endothelial grow th factor binding	IEA	molecular_function
GO:0042493	response to drug	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043086	negative regulation of ca talytic activity	IEA	biological_process
GO:0043394	proteoglycan binding	IEA	molecular_function
GO:0044849	estrous cycle	IEA	biological_process
GO:0045446	endothelial cell differen tiation	IEA	biological_process
GO:0045837	negative regulation of me mbrane potential	IEA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0050680	negative regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:0060041	retina development in cam era-type eye	IEA	biological_process
GO:0060221	retinal rod cell differen tiation	IEA	biological_process
GO:0060253	negative regulation of gl ial cell proliferation	IEA	biological_process
GO:0060291	long-term synaptic potent iation	IEA	biological_process
GO:0071305	cellular response to vita min D	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0072201	negative regulation of me senchymal cell proliferat ion	IEA	biological_process
GO:1904373	response to kainic acid	IEA	biological_process
GO:1904389	rod bipolar cell differen tiation	IEA	biological_process
GO:1904391	response to ciliary neuro trophic factor	IEA	biological_process
GO:1904395	positive regulation of sk eletal muscle acetylcholi ne-gated channel clusteri ng	IEA	biological_process
GO:1904397	negative regulation of ne uromuscular junction deve lopment	IEA	biological_process
GO:1904399	heparan sulfate binding	IEA	molecular_function
GO:1990089	response to nerve growth factor	IEA	biological_process
GO:2000347	positive regulation of he patocyte proliferation	IEA	biological_process
GO:0004864	protein phosphatase inhib itor activity	TAS	molecular_function
GO:0005615	extracellular space	TAS	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0007185	transmembrane receptor pr otein tyrosine phosphatas e signaling pathway	TAS	biological_process
GO:0007399	nervous system developmen t	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process

Diseases

Associated diseases	References
Endometriosis	PMID: 11912283
Endometriosis	INFBASE11912283
Psychiatric disorders	PMID: 19086053

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
11912283	Endometrio sis			60 (30 women wi th severe, stag es III and IV e ndometriosis, 3 0 women without endometriosis)			Show abstract