Endometriosis Knowledgebase

Search Result

Gene id

5801

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PTPRR Gene UCSC Ensembl

Aliases

EC-PTP, PCPTP1, PTP-SL, PTPBR7, PTPRQ

Gene name

protein tyrosine phosphatase, receptor type R

Alternate names

receptor-type tyrosine-protein phosphatase R, Ch-1 PTPase, NC-PTPCOM1, R-PTP-R, ch-1PTPase, protein tyrosine phosphatase Cr1PTPase, protein-tyrosine phosphatase NC-PTPCOM1, protein-tyrosine phosphatase PCPTP1,

Gene location

12q15 (70920803: 70638072) Exons: 19 NC_000012.12

Gene summary(Entrez)

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domain, and thus represents a receptor-type PTP. Silencing of this gene has been associated with colorectal cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares a symbol (PTPRQ) with another gene, protein tyrosine phosphatase, receptor type, Q (GeneID 374462), which is also located on chromosome 12. [provided by RefSeq, May 2011]

OMIM

602853

Protein Summary

Protein general information

Q15256

Name: Receptor type tyrosine protein phosphatase R (R PTP R) (EC 3.1.3.48) (Ch 1PTPase) (NC PTPCOM1) (Protein tyrosine phosphatase PCPTP1)

Length: 657 Mass: 73,834

Tissue specificity: Expressed in brain, placenta, small intestine, stomach, uterus and weakly in the prostate. Isoform alpha has been observed only in the brain. Isoform gamma is expressed in brain, placenta and uterus. Isoform delta is expressed in brain

Sequence

MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDIEKSLDIAPQKIYRHSYHSSSEAQVS
KRHQIVNSAFPRPAYDPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGVAAALGLLPQQ
VHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHEADKIWSK
EGFYAVVIFLSIFVIIVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLN
VVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMEYLQSAS
RILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTILPNPLSRVCLRPKNVTDSLSTYINAN
YIRGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNEC
DNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIA
TSIGCQQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ

Structural information

Protein Domains	Tyrosine-protein (393-647)
Interpro:	IPR029021 IPR000242 IPR016130 IPR003595 IPR008356 IPR016334 IPR000387
Prosite:	PS00383 PS50056 PS50055
Pfam:	PF00102
PDB:	2A8B
PDBsum:	2A8B
DIP:	42066
MINT:	1350037
STRING:	ENSP00000283228;

Other Databases

GeneCards: PTPRR; Malacards: PTPRR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001701	in utero embryonic develo pment	IEP	biological_process
GO:0004725	protein tyrosine phosphat ase activity	TAS	molecular_function
GO:0005001	transmembrane receptor pr otein tyrosine phosphatas e activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006470	protein dephosphorylation	TAS	biological_process
GO:0010633	negative regulation of ep ithelial cell migration	IMP	biological_process
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019901	protein kinase binding	ISS	molecular_function
GO:0030054	cell junction	IDA	cellular_component
GO:0030182	neuron differentiation	IEA	biological_process
GO:0035335	peptidyl-tyrosine dephosp horylation	IEA	biological_process
GO:0038128	ERBB2 signaling pathway	IMP	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0070373	negative regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:1903385	regulation of homophilic cell adhesion	IMP	biological_process
GO:0001701	in utero embryonic develo pment	IEP	biological_process
GO:0004721	phosphoprotein phosphatas e activity	IEA	molecular_function
GO:0004725	protein tyrosine phosphat ase activity	IEA	molecular_function
GO:0004725	protein tyrosine phosphat ase activity	IEA	molecular_function
GO:0004725	protein tyrosine phosphat ase activity	IEA	molecular_function
GO:0004725	protein tyrosine phosphat ase activity	TAS	molecular_function
GO:0005001	transmembrane receptor pr otein tyrosine phosphatas e activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006470	protein dephosphorylation	IEA	biological_process
GO:0006470	protein dephosphorylation	IEA	biological_process
GO:0006470	protein dephosphorylation	TAS	biological_process
GO:0007399	nervous system developmen t	IEA	biological_process
GO:0010633	negative regulation of ep ithelial cell migration	IMP	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016311	dephosphorylation	IEA	biological_process
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0016791	phosphatase activity	IEA	molecular_function
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0019901	protein kinase binding	ISS	molecular_function
GO:0030054	cell junction	IDA	cellular_component
GO:0030182	neuron differentiation	IEA	biological_process
GO:0035335	peptidyl-tyrosine dephosp horylation	IEA	biological_process
GO:0038128	ERBB2 signaling pathway	IMP	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0070373	negative regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:1903385	regulation of homophilic cell adhesion	IMP	biological_process
GO:0001701	in utero embryonic develo pment	IEP	biological_process
GO:0004725	protein tyrosine phosphat ase activity	TAS	molecular_function
GO:0005001	transmembrane receptor pr otein tyrosine phosphatas e activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006470	protein dephosphorylation	TAS	biological_process
GO:0010633	negative regulation of ep ithelial cell migration	IMP	biological_process
GO:0019901	protein kinase binding	ISS	molecular_function
GO:0030054	cell junction	IDA	cellular_component
GO:0038128	ERBB2 signaling pathway	IMP	biological_process
GO:0070373	negative regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:1903385	regulation of homophilic cell adhesion	IMP	biological_process

KEGG pathways

hsa04010 MAPK signaling pathway

Diseases

Associated diseases	References
Endometriosis	PMID: 18353903
Endometriosis	INFBASE18353903
Parkinson's disease	PMID: 17052657

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
18353903	Endometrio sis			16 (10 patients with laparosco pically proven endometriosis ( minimal/mild n = 5 and moderat e/severe n = 5) , 6 controls)		PCDH17 PTPRR IL6ST	Show abstract