Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 5806
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol PTX3   Gene   UCSC   Ensembl
Aliases TNFAIP5, TSG-14
Gene name pentraxin 3
Alternate names pentraxin-related protein PTX3, TNF alpha-induced protein 5, long pentraxin 3, tumor necrosis factor alpha-induced protein 5, tumor necrosis factor-inducible gene 14 protein, tumor necrosis factor-inducible protein TSG-14,
Gene location 3q25.32 (157436790: 157443627)     Exons: 3     NC_000003.12
Gene summary(Entrez) This gene encodes a member of the pentraxin protein family. The expression of this protein is induced by inflammatory cytokines in response to inflammatory stimuli in several mesenchymal and epithelial cell types, particularly endothelial cells and mononuclear phagocytes. The protein promotes fibrocyte differentiation and is involved in regulating inflammation and complement activation. It also plays a role in angiogenesis and tissue remodeling. The protein serves as a biomarker for several inflammatory conditions. [provided by RefSeq, Jun 2016]
OMIM 602492

Protein Summary

Protein general information P26022  

Name: Pentraxin related protein PTX3 (Pentaxin related protein PTX3) (Tumor necrosis factor alpha induced protein 5) (TNF alpha induced protein 5) (Tumor necrosis factor inducible gene 14 protein) (TSG 14)

Length: 381  Mass: 41,976

Sequence MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLFIMLENSQMRERMLLQ
ATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDELLQATRDAGRRLARMEGAEAQRPEEAGRALA
AVLEELRQTRADLHAVQGWAARSWLPAGCETAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILF
SYGTKRNPYEIQLYLSYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGH
IVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHG
GAQYVS
Structural information
Protein Domains
Pentraxin (179-381)
Interpro:  IPR013320 IPR006558 IPR030476 IPR001759
Prosite:   PS00289 PS51828

Pfam:  
PF00354
CDD:   cd00152
STRING:   ENSP00000295927;
Other Databases GeneCards:  PTX3;  Malacards:  PTX3

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001849 complement component C1q
binding
IDA molecular_function
GO:0001872 (1->3)-beta-D-glucan bind
ing
IEA molecular_function
GO:0001878 response to yeast
IEA biological_process
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0006954 inflammatory response
TAS biological_process
GO:0008228 opsonization
IEA biological_process
GO:0044869 negative regulation by ho
st of viral exo-alpha-sia
lidase activity
IDA biological_process
GO:0044871 negative regulation by ho
st of viral glycoprotein
metabolic process
IDA biological_process
GO:0045087 innate immune response
IDA biological_process
GO:0045429 positive regulation of ni
tric oxide biosynthetic p
rocess
IEA biological_process
GO:0046597 negative regulation of vi
ral entry into host cell
IDA biological_process
GO:0046790 virion binding
IDA molecular_function
GO:0050766 positive regulation of ph
agocytosis
IEA biological_process
GO:1903016 negative regulation of ex
o-alpha-sialidase activit
y
IDA biological_process
GO:1903019 negative regulation of gl
ycoprotein metabolic proc
ess
IDA biological_process
GO:0001849 complement component C1q
binding
IDA molecular_function
GO:0001872 (1->3)-beta-D-glucan bind
ing
IEA molecular_function
GO:0001878 response to yeast
IEA biological_process
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0006954 inflammatory response
TAS biological_process
GO:0008228 opsonization
IEA biological_process
GO:0044869 negative regulation by ho
st of viral exo-alpha-sia
lidase activity
IDA biological_process
GO:0044871 negative regulation by ho
st of viral glycoprotein
metabolic process
IDA biological_process
GO:0045087 innate immune response
IDA biological_process
GO:0045429 positive regulation of ni
tric oxide biosynthetic p
rocess
IEA biological_process
GO:0046597 negative regulation of vi
ral entry into host cell
IDA biological_process
GO:0046790 virion binding
IDA molecular_function
GO:0050766 positive regulation of ph
agocytosis
IEA biological_process
GO:1903016 negative regulation of ex
o-alpha-sialidase activit
y
IDA biological_process
GO:1903019 negative regulation of gl
ycoprotein metabolic proc
ess
IDA biological_process
GO:0001849 complement component C1q
binding
IDA molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0006954 inflammatory response
TAS biological_process
GO:0044869 negative regulation by ho
st of viral exo-alpha-sia
lidase activity
IDA biological_process
GO:0044871 negative regulation by ho
st of viral glycoprotein
metabolic process
IDA biological_process
GO:0045087 innate immune response
IDA biological_process
GO:0046597 negative regulation of vi
ral entry into host cell
IDA biological_process
GO:0046790 virion binding
IDA molecular_function
GO:1903016 negative regulation of ex
o-alpha-sialidase activit
y
IDA biological_process
GO:1903019 negative regulation of gl
ycoprotein metabolic proc
ess
IDA biological_process

Diseases

Associated diseases References
Endometriosis (ovarian) PMID: 22633261
Female infertility PMID: 19846603
Hyperandrogenism PMID: 24347428
Ovarian endometriosis INFBASE22633261
Oocyte development PMID: 15831290
Ovarian endometriosis PMID: 22633261
Polycystic ovary syndrome (PCOS) PMID: 24347428

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
22633261 Endometrio
sis (ovari
an)



Show abstract