Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 58191
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol CXCL16   Gene   UCSC   Ensembl
Aliases CXCLG16, SR-PSOX, SRPSOX
Gene name C-X-C motif chemokine ligand 16
Alternate names C-X-C motif chemokine 16, CXC chemokine ligand 16, chemokine (C-X-C motif) ligand 16, scavenger receptor for phosphatidylserine and oxidized low density lipoprotein, small-inducible cytokine B16, transmembrane chemokine CXCL16,
Gene location 17p13.2 (4739927: 4733528)     Exons: 6     NC_000017.11
OMIM 605398

Protein Summary

Protein general information Q9H2A7  

Name: C X C motif chemokine 16 (Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein) (SR PSOX) (Small inducible cytokine B16) (Transmembrane chemokine CXCL16)

Length: 254  Mass: 27,579

Tissue specificity: Expressed in T-cell areas. Expressed in spleen, lymph nodes, lung, kidney, small intestine and thymus. Weak expression in heart and liver and no expression in brain and bone marrow.

Sequence MGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQ
LLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQR
PTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAALSYV
LCKRRRGQSPQSSPDLPVHYIPVAPDSNT
Structural information
Interpro:  IPR026296
STRING:   ENSP00000293778;
Other Databases GeneCards:  CXCL16;  Malacards:  CXCL16

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0005041 low-density lipoprotein r
eceptor activity
ISS molecular_function
GO:0005041 low-density lipoprotein r
eceptor activity
IBA molecular_function
GO:0005044 scavenger receptor activi
ty
TAS molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0006898 receptor-mediated endocyt
osis
NAS biological_process
GO:0006935 chemotaxis
NAS biological_process
GO:0008009 chemokine activity
ISS molecular_function
GO:0008009 chemokine activity
IDA molecular_function
GO:0010818 T cell chemotaxis
IBA biological_process
GO:0016020 membrane
TAS cellular_component
GO:0016021 integral component of mem
brane
NAS cellular_component
GO:0030307 positive regulation of ce
ll growth
IMP biological_process
GO:0030335 positive regulation of ce
ll migration
IMP biological_process
GO:0034097 response to cytokine
IDA biological_process
GO:0034341 response to interferon-ga
mma
IDA biological_process
GO:0034612 response to tumor necrosi
s factor
IDA biological_process
GO:0071222 cellular response to lipo
polysaccharide
IEA biological_process
GO:0005041 low-density lipoprotein r
eceptor activity
IEA molecular_function
GO:0005041 low-density lipoprotein r
eceptor activity
IEA molecular_function
GO:0005041 low-density lipoprotein r
eceptor activity
ISS molecular_function
GO:0005041 low-density lipoprotein r
eceptor activity
IBA molecular_function
GO:0005044 scavenger receptor activi
ty
IEA molecular_function
GO:0005044 scavenger receptor activi
ty
IEA molecular_function
GO:0005044 scavenger receptor activi
ty
TAS molecular_function
GO:0005125 cytokine activity
IEA molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0006898 receptor-mediated endocyt
osis
IEA biological_process
GO:0006898 receptor-mediated endocyt
osis
NAS biological_process
GO:0006935 chemotaxis
IEA biological_process
GO:0006935 chemotaxis
IEA biological_process
GO:0006935 chemotaxis
NAS biological_process
GO:0008009 chemokine activity
IEA molecular_function
GO:0008009 chemokine activity
IEA molecular_function
GO:0008009 chemokine activity
ISS molecular_function
GO:0008009 chemokine activity
IDA molecular_function
GO:0010818 T cell chemotaxis
IEA biological_process
GO:0010818 T cell chemotaxis
IBA biological_process
GO:0016020 membrane
IEA cellular_component
GO:0016020 membrane
TAS cellular_component
GO:0016021 integral component of mem
brane
IEA cellular_component
GO:0016021 integral component of mem
brane
IEA cellular_component
GO:0016021 integral component of mem
brane
NAS cellular_component
GO:0030307 positive regulation of ce
ll growth
IEA biological_process
GO:0030307 positive regulation of ce
ll growth
IMP biological_process
GO:0030335 positive regulation of ce
ll migration
IEA biological_process
GO:0030335 positive regulation of ce
ll migration
IMP biological_process
GO:0034097 response to cytokine
IEA biological_process
GO:0034097 response to cytokine
IDA biological_process
GO:0034341 response to interferon-ga
mma
IEA biological_process
GO:0034341 response to interferon-ga
mma
IDA biological_process
GO:0034612 response to tumor necrosi
s factor
IEA biological_process
GO:0034612 response to tumor necrosi
s factor
IDA biological_process
GO:0042379 chemokine receptor bindin
g
IEA molecular_function
GO:0048247 lymphocyte chemotaxis
IEA biological_process
GO:0071222 cellular response to lipo
polysaccharide
IEA biological_process
GO:0005041 low-density lipoprotein r
eceptor activity
ISS molecular_function
GO:0005041 low-density lipoprotein r
eceptor activity
IBA molecular_function
GO:0005044 scavenger receptor activi
ty
TAS molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0006898 receptor-mediated endocyt
osis
NAS biological_process
GO:0006935 chemotaxis
NAS biological_process
GO:0008009 chemokine activity
ISS molecular_function
GO:0008009 chemokine activity
IDA molecular_function
GO:0010818 T cell chemotaxis
IBA biological_process
GO:0016020 membrane
TAS cellular_component
GO:0016021 integral component of mem
brane
NAS cellular_component
GO:0030307 positive regulation of ce
ll growth
IMP biological_process
GO:0030335 positive regulation of ce
ll migration
IMP biological_process
GO:0034097 response to cytokine
IDA biological_process
GO:0034341 response to interferon-ga
mma
IDA biological_process
GO:0034612 response to tumor necrosi
s factor
IDA biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway

Diseases

Associated diseases References
Atherosclerosis PMID: 15836657
Chronic kidney failure PMID: 19578796
Endometriosis PMID: 21773780
Endometriosis INFBASE21773780

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21773780 Endometrio
sis


CXCL16
Show abstract