Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 5879
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol RAC1   Gene   UCSC   Ensembl
Aliases MIG5, MRD48, Rac-1, TC-25, p21-Rac1
Gene name Rac family small GTPase 1
Alternate names ras-related C3 botulinum toxin substrate 1, cell migration-inducing gene 5 protein, ras-like protein TC25, ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1),
Gene location 7p22.1 (6374494: 6403966)     Exons: 7     NC_000007.14
Gene summary(Entrez) The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]
OMIM 602048

Protein Summary

Protein general information P63000  

Name: Ras-related C3 botulinum toxin substrate 1 (Cell migration-inducing gene 5 protein) (Ras-like protein TC25) (p21-Rac1)

Length: 192  Mass: 21,450

Tissue specificity: Isoform B is predominantly identified in skin and epithelial tissues from the intestinal tract. Its expression is elevated in colorectal tumors at various stages of neoplastic progression, as compared to their respective adjacent tissu

Sequence MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQT
DVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIG
AVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
Structural information

Motifs
Effector region.(32-40)
Interpro:  IPR027417 IPR005225 IPR001806 IPR003578
Prosite:   PS51420

Pfam:  
PF00071

PDB:  
1E96 1FOE 1G4U 1HE1 1HH4 1I4D 1I4L 1I4T 1MH1 1RYF 1RYH 2FJU 2H7V 2NZ8 2P2L 2RMK 2VRW 2WKP 2WKQ 2WKR 2YIN 3B13 3BJI 3RYT 3SBD 3SBE 3SU8 3SUA 3TH5 4GZL 4GZM 4YON 5FI0 5HZH 5N6O 5O33 6BC1
PDBsum:   1E96 1FOE 1G4U 1HE1 1HH4 1I4D 1I4L 1I4T 1MH1 1RYF 1RYH 2FJU 2H7V 2NZ8 2P2L 2RMK 2VRW 2WKP 2WKQ 2WKR 2YIN 3B13 3BJI 3RYT 3SBD 3SBE 3SU8 3SUA 3TH5 4GZL 4GZM 4YON 5FI0 5HZH 5N6O 5O33 6BC1

DIP:  
29260
MINT:  
Other Databases GeneCards:  RAC1;  Malacards:  RAC1

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000139 Golgi membrane
IEA cellular_component
GO:0001891 phagocytic cup
IEA cellular_component
GO:0001934 positive regulation of pr
otein phosphorylation
IMP biological_process
GO:0002093 auditory receptor cell mo
rphogenesis
IEA biological_process
GO:0002551 mast cell chemotaxis
IEA biological_process
GO:0003382 epithelial cell morphogen
esis
IEA biological_process
GO:0003924 GTPase activity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005525 GTP binding
IMP molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005634 nucleus
IEA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular_component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular_component
GO:0005802 trans-Golgi network
IDA cellular_component
GO:0005829 cytosol
ISS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005925 focal adhesion
IDA cellular_component
GO:0006928 movement of cell or subce
llular component
TAS biological_process
GO:0006954 inflammatory response
TAS biological_process
GO:0006972 hyperosmotic response
IEA biological_process
GO:0007155 cell adhesion
TAS biological_process
GO:0007160 cell-matrix adhesion
NAS biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IEA biological_process
GO:0007264 small GTPase mediated sig
nal transduction
IEA biological_process
GO:0007411 axon guidance
IEA biological_process
GO:0007596 blood coagulation
TAS biological_process
GO:0008283 cell proliferation
IEA biological_process
GO:0008361 regulation of cell size
IGI biological_process
GO:0008361 regulation of cell size
IMP biological_process
GO:0009611 response to wounding
TAS biological_process
GO:0009653 anatomical structure morp
hogenesis
TAS biological_process
GO:0010310 regulation of hydrogen pe
roxide metabolic process
TAS biological_process
GO:0010592 positive regulation of la
mellipodium assembly
IDA biological_process
GO:0010592 positive regulation of la
mellipodium assembly
IMP biological_process
GO:0010762 regulation of fibroblast
migration
IEA biological_process
GO:0010811 positive regulation of ce
ll-substrate adhesion
IGI biological_process
GO:0014041 regulation of neuron matu
ration
IEA biological_process
GO:0016020 membrane
ISS cellular_component
GO:0017137 Rab GTPase binding
IEA molecular_function
GO:0019897 extrinsic component of pl
asma membrane
IEA cellular_component
GO:0019899 enzyme binding
IPI molecular_function
GO:0019901 protein kinase binding
IEA molecular_function
GO:0021799 cerebral cortex radially
oriented cell migration
IEA biological_process
GO:0021831 embryonic olfactory bulb
interneuron precursor mig
ration
IEA biological_process
GO:0021894 cerebral cortex GABAergic
interneuron development
IEA biological_process
GO:0030027 lamellipodium
IDA cellular_component
GO:0030032 lamellipodium assembly
IMP biological_process
GO:0030036 actin cytoskeleton organi
zation
IGI biological_process
GO:0030041 actin filament polymeriza
tion
TAS biological_process
GO:0030168 platelet activation
TAS biological_process
GO:0030334 regulation of cell migrat
ion
IMP biological_process
GO:0030334 regulation of cell migrat
ion
IMP biological_process
GO:0030742 GTP-dependent protein bin
ding
IEA molecular_function
GO:0030838 positive regulation of ac
tin filament polymerizati
on
IEA biological_process
GO:0031295 T cell costimulation
TAS biological_process
GO:0031529 ruffle organization
IDA biological_process
GO:0031529 ruffle organization
TAS biological_process
GO:0031901 early endosome membrane
IEA cellular_component
GO:0031996 thioesterase binding
IPI molecular_function
GO:0032587 ruffle membrane
IEA cellular_component
GO:0032707 negative regulation of in
terleukin-23 production
IDA biological_process
GO:0034446 substrate adhesion-depend
ent cell spreading
IMP biological_process
GO:0035025 positive regulation of Rh
o protein signal transduc
tion
TAS biological_process
GO:0035556 intracellular signal tran
sduction
TAS biological_process
GO:0036464 cytoplasmic ribonucleopro
tein granule
IDA cellular_component
GO:0038095 Fc-epsilon receptor signa
ling pathway
TAS biological_process
GO:0038096 Fc-gamma receptor signali
ng pathway involved in ph
agocytosis
TAS biological_process
GO:0042470 melanosome
IEA cellular_component
GO:0042826 histone deacetylase bindi
ng
IEA molecular_function
GO:0043065 positive regulation of ap
optotic process
TAS biological_process
GO:0043552 positive regulation of ph
osphatidylinositol 3-kina
se activity
IEA biological_process
GO:0043652 engulfment of apoptotic c
ell
IEA biological_process
GO:0045216 cell-cell junction organi
zation
IEA biological_process
GO:0045453 bone resorption
IEA biological_process
GO:0045740 positive regulation of DN
A replication
IEA biological_process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
TAS biological_process
GO:0048013 ephrin receptor signaling
pathway
TAS biological_process
GO:0048261 negative regulation of re
ceptor-mediated endocytos
is
TAS biological_process
GO:0048532 anatomical structure arra
ngement
IEA biological_process
GO:0048813 dendrite morphogenesis
IEA biological_process
GO:0048870 cell motility
IDA biological_process
GO:0048873 homeostasis of number of
cells within a tissue
IEA biological_process
GO:0050690 regulation of defense res
ponse to virus by virus
TAS biological_process
GO:0051022 Rho GDP-dissociation inhi
bitor binding
ISS molecular_function
GO:0051056 regulation of small GTPas
e mediated signal transdu
ction
TAS biological_process
GO:0051496 positive regulation of st
ress fiber assembly
IDA biological_process
GO:0051668 localization within membr
ane
IMP biological_process
GO:0051894 positive regulation of fo
cal adhesion assembly
IDA biological_process
GO:0051932 synaptic transmission, GA
BAergic
IEA biological_process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
NAS biological_process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
TAS biological_process
GO:0060263 regulation of respiratory
burst
IDA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0071260 cellular response to mech
anical stimulus
IEA biological_process
GO:0071526 semaphorin-plexin signali
ng pathway
ISS biological_process
GO:0071542 dopaminergic neuron diffe
rentiation
IEA biological_process
GO:0072659 protein localization to p
lasma membrane
IEA biological_process
GO:0090023 positive regulation of ne
utrophil chemotaxis
IMP biological_process
GO:0090103 cochlea morphogenesis
IEA biological_process
GO:0097178 ruffle assembly
IEA biological_process
GO:1900026 positive regulation of su
bstrate adhesion-dependen
t cell spreading
IDA biological_process
GO:0005884 actin filament
IDA cellular_component
GO:0000139 Golgi membrane
IEA cellular_component
GO:0000166 nucleotide binding
IEA molecular_function
GO:0001891 phagocytic cup
IEA cellular_component
GO:0001934 positive regulation of pr
otein phosphorylation
IMP biological_process
GO:0002093 auditory receptor cell mo
rphogenesis
IEA biological_process
GO:0002551 mast cell chemotaxis
IEA biological_process
GO:0003382 epithelial cell morphogen
esis
IEA biological_process
GO:0003924 GTPase activity
IEA molecular_function
GO:0003924 GTPase activity
TAS molecular_function
GO:0003924 GTPase activity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005525 GTP binding
IEA molecular_function
GO:0005525 GTP binding
IEA molecular_function
GO:0005525 GTP binding
IEA molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005525 GTP binding
IMP molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005634 nucleus
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular_component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular_component
GO:0005802 trans-Golgi network
IDA cellular_component
GO:0005829 cytosol
IEA cellular_component
GO:0005829 cytosol
ISS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005925 focal adhesion
IDA cellular_component
GO:0006897 endocytosis
IEA biological_process
GO:0006911 phagocytosis, engulfment
IEA biological_process
GO:0006928 movement of cell or subce
llular component
TAS biological_process
GO:0006935 chemotaxis
IEA biological_process
GO:0006954 inflammatory response
TAS biological_process
GO:0006972 hyperosmotic response
IEA biological_process
GO:0007010 cytoskeleton organization
IEA biological_process
GO:0007015 actin filament organizati
on
IEA biological_process
GO:0007155 cell adhesion
IEA biological_process
GO:0007155 cell adhesion
TAS biological_process
GO:0007160 cell-matrix adhesion
NAS biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IEA biological_process
GO:0007264 small GTPase mediated sig
nal transduction
IEA biological_process
GO:0007264 small GTPase mediated sig
nal transduction
IEA biological_process
GO:0007411 axon guidance
IEA biological_process
GO:0007596 blood coagulation
TAS biological_process
GO:0008283 cell proliferation
IEA biological_process
GO:0008361 regulation of cell size
IGI biological_process
GO:0008361 regulation of cell size
IMP biological_process
GO:0009611 response to wounding
TAS biological_process
GO:0009653 anatomical structure morp
hogenesis
TAS biological_process
GO:0010310 regulation of hydrogen pe
roxide metabolic process
TAS biological_process
GO:0010592 positive regulation of la
mellipodium assembly
IEA biological_process
GO:0010592 positive regulation of la
mellipodium assembly
IDA biological_process
GO:0010592 positive regulation of la
mellipodium assembly
IMP biological_process
GO:0010762 regulation of fibroblast
migration
IEA biological_process
GO:0010811 positive regulation of ce
ll-substrate adhesion
IGI biological_process
GO:0014041 regulation of neuron matu
ration
IEA biological_process
GO:0016020 membrane
IEA cellular_component
GO:0016020 membrane
ISS cellular_component
GO:0016020 membrane
IEA cellular_component
GO:0016358 dendrite development
IEA biological_process
GO:0016477 cell migration
IEA biological_process
GO:0017137 Rab GTPase binding
IEA molecular_function
GO:0019897 extrinsic component of pl
asma membrane
IEA cellular_component
GO:0019899 enzyme binding
IPI molecular_function
GO:0019901 protein kinase binding
IEA molecular_function
GO:0021799 cerebral cortex radially
oriented cell migration
IEA biological_process
GO:0021831 embryonic olfactory bulb
interneuron precursor mig
ration
IEA biological_process
GO:0021894 cerebral cortex GABAergic
interneuron development
IEA biological_process
GO:0022604 regulation of cell morpho
genesis
IEA biological_process
GO:0030027 lamellipodium
IEA cellular_component
GO:0030027 lamellipodium
IDA cellular_component
GO:0030032 lamellipodium assembly
IEA biological_process
GO:0030032 lamellipodium assembly
IMP biological_process
GO:0030036 actin cytoskeleton organi
zation
IEA biological_process
GO:0030036 actin cytoskeleton organi
zation
IGI biological_process
GO:0030041 actin filament polymeriza
tion
IEA biological_process
GO:0030041 actin filament polymeriza
tion
TAS biological_process
GO:0030168 platelet activation
TAS biological_process
GO:0030334 regulation of cell migrat
ion
IEA biological_process
GO:0030334 regulation of cell migrat
ion
IMP biological_process
GO:0030334 regulation of cell migrat
ion
IMP biological_process
GO:0030742 GTP-dependent protein bin
ding
IEA molecular_function
GO:0030838 positive regulation of ac
tin filament polymerizati
on
IEA biological_process
GO:0031295 T cell costimulation
TAS biological_process
GO:0031410 cytoplasmic vesicle
IEA cellular_component
GO:0031529 ruffle organization
IDA biological_process
GO:0031529 ruffle organization
TAS biological_process
GO:0031901 early endosome membrane
IEA cellular_component
GO:0031996 thioesterase binding
IPI molecular_function
GO:0032587 ruffle membrane
IEA cellular_component
GO:0032707 negative regulation of in
terleukin-23 production
IDA biological_process
GO:0034446 substrate adhesion-depend
ent cell spreading
IEA biological_process
GO:0034446 substrate adhesion-depend
ent cell spreading
IMP biological_process
GO:0035025 positive regulation of Rh
o protein signal transduc
tion
TAS biological_process
GO:0035556 intracellular signal tran
sduction
TAS biological_process
GO:0035567 non-canonical Wnt signali
ng pathway
IEA biological_process
GO:0036464 cytoplasmic ribonucleopro
tein granule
IDA cellular_component
GO:0038095 Fc-epsilon receptor signa
ling pathway
TAS biological_process
GO:0038096 Fc-gamma receptor signali
ng pathway involved in ph
agocytosis
TAS biological_process
GO:0042470 melanosome
IEA cellular_component
GO:0042826 histone deacetylase bindi
ng
IEA molecular_function
GO:0042995 cell projection
IEA cellular_component
GO:0043065 positive regulation of ap
optotic process
TAS biological_process
GO:0043552 positive regulation of ph
osphatidylinositol 3-kina
se activity
IEA biological_process
GO:0043652 engulfment of apoptotic c
ell
IEA biological_process
GO:0045216 cell-cell junction organi
zation
IEA biological_process
GO:0045453 bone resorption
IEA biological_process
GO:0045740 positive regulation of DN
A replication
IEA biological_process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
TAS biological_process
GO:0048013 ephrin receptor signaling
pathway
TAS biological_process
GO:0048261 negative regulation of re
ceptor-mediated endocytos
is
TAS biological_process
GO:0048532 anatomical structure arra
ngement
IEA biological_process
GO:0048812 neuron projection morphog
enesis
IEA biological_process
GO:0048813 dendrite morphogenesis
IEA biological_process
GO:0048870 cell motility
IDA biological_process
GO:0048873 homeostasis of number of
cells within a tissue
IEA biological_process
GO:0050690 regulation of defense res
ponse to virus by virus
TAS biological_process
GO:0051022 Rho GDP-dissociation inhi
bitor binding
IEA molecular_function
GO:0051022 Rho GDP-dissociation inhi
bitor binding
ISS molecular_function
GO:0051056 regulation of small GTPas
e mediated signal transdu
ction
TAS biological_process
GO:0051496 positive regulation of st
ress fiber assembly
IDA biological_process
GO:0051668 localization within membr
ane
IMP biological_process
GO:0051894 positive regulation of fo
cal adhesion assembly
IDA biological_process
GO:0051932 synaptic transmission, GA
BAergic
IEA biological_process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
IEA biological_process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
NAS biological_process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
TAS biological_process
GO:0060263 regulation of respiratory
burst
IDA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0071260 cellular response to mech
anical stimulus
IEA biological_process
GO:0071526 semaphorin-plexin signali
ng pathway
IEA biological_process
GO:0071526 semaphorin-plexin signali
ng pathway
ISS biological_process
GO:0071542 dopaminergic neuron diffe
rentiation
IEA biological_process
GO:0072659 protein localization to p
lasma membrane
IEA biological_process
GO:0090023 positive regulation of ne
utrophil chemotaxis
IEA biological_process
GO:0090023 positive regulation of ne
utrophil chemotaxis
IMP biological_process
GO:0090103 cochlea morphogenesis
IEA biological_process
GO:0097178 ruffle assembly
IEA biological_process
GO:1900026 positive regulation of su
bstrate adhesion-dependen
t cell spreading
IDA biological_process
GO:0005884 actin filament
IDA cellular_component
GO:0001934 positive regulation of pr
otein phosphorylation
IMP biological_process
GO:0003924 GTPase activity
TAS molecular_function
GO:0003924 GTPase activity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005525 GTP binding
IMP molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005737 cytoplasm
IDA cellular_component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular_component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular_component
GO:0005802 trans-Golgi network
IDA cellular_component
GO:0005829 cytosol
ISS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005925 focal adhesion
IDA cellular_component
GO:0006928 movement of cell or subce
llular component
TAS biological_process
GO:0006954 inflammatory response
TAS biological_process
GO:0007155 cell adhesion
TAS biological_process
GO:0007160 cell-matrix adhesion
NAS biological_process
GO:0007596 blood coagulation
TAS biological_process
GO:0008361 regulation of cell size
IGI biological_process
GO:0008361 regulation of cell size
IMP biological_process
GO:0009611 response to wounding
TAS biological_process
GO:0009653 anatomical structure morp
hogenesis
TAS biological_process
GO:0010310 regulation of hydrogen pe
roxide metabolic process
TAS biological_process
GO:0010592 positive regulation of la
mellipodium assembly
IDA biological_process
GO:0010592 positive regulation of la
mellipodium assembly
IMP biological_process
GO:0010811 positive regulation of ce
ll-substrate adhesion
IGI biological_process
GO:0016020 membrane
ISS cellular_component
GO:0019899 enzyme binding
IPI molecular_function
GO:0030027 lamellipodium
IDA cellular_component
GO:0030032 lamellipodium assembly
IMP biological_process
GO:0030036 actin cytoskeleton organi
zation
IGI biological_process
GO:0030041 actin filament polymeriza
tion
TAS biological_process
GO:0030168 platelet activation
TAS biological_process
GO:0030334 regulation of cell migrat
ion
IMP biological_process
GO:0030334 regulation of cell migrat
ion
IMP biological_process
GO:0031295 T cell costimulation
TAS biological_process
GO:0031529 ruffle organization
IDA biological_process
GO:0031529 ruffle organization
TAS biological_process
GO:0031996 thioesterase binding
IPI molecular_function
GO:0032707 negative regulation of in
terleukin-23 production
IDA biological_process
GO:0034446 substrate adhesion-depend
ent cell spreading
IMP biological_process
GO:0035025 positive regulation of Rh
o protein signal transduc
tion
TAS biological_process
GO:0035556 intracellular signal tran
sduction
TAS biological_process
GO:0036464 cytoplasmic ribonucleopro
tein granule
IDA cellular_component
GO:0038095 Fc-epsilon receptor signa
ling pathway
TAS biological_process
GO:0038096 Fc-gamma receptor signali
ng pathway involved in ph
agocytosis
TAS biological_process
GO:0043065 positive regulation of ap
optotic process
TAS biological_process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
TAS biological_process
GO:0048013 ephrin receptor signaling
pathway
TAS biological_process
GO:0048261 negative regulation of re
ceptor-mediated endocytos
is
TAS biological_process
GO:0048870 cell motility
IDA biological_process
GO:0050690 regulation of defense res
ponse to virus by virus
TAS biological_process
GO:0051022 Rho GDP-dissociation inhi
bitor binding
ISS molecular_function
GO:0051056 regulation of small GTPas
e mediated signal transdu
ction
TAS biological_process
GO:0051496 positive regulation of st
ress fiber assembly
IDA biological_process
GO:0051668 localization within membr
ane
IMP biological_process
GO:0051894 positive regulation of fo
cal adhesion assembly
IDA biological_process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
NAS biological_process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
TAS biological_process
GO:0060263 regulation of respiratory
burst
IDA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0071526 semaphorin-plexin signali
ng pathway
ISS biological_process
GO:0090023 positive regulation of ne
utrophil chemotaxis
IMP biological_process
GO:1900026 positive regulation of su
bstrate adhesion-dependen
t cell spreading
IDA biological_process
GO:0005884 actin filament
IDA cellular_component

KEGG pathways

hsa04024  cAMP signaling pathway
hsa05210  Colorectal cancer
hsa04620  Toll-like receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04380  Osteoclast differentiation
hsa04071  Sphingolipid signaling pathway
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04310  Wnt signaling pathway
hsa05231  Choline metabolism in cancer
hsa04662  B cell receptor signaling pathway
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa04014  Ras signaling pathway
hsa05132  Salmonella infection
hsa04370  VEGF signaling pathway
hsa05211  Renal cell carcinoma
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa04972  Pancreatic secretion
hsa04670  Leukocyte transendothelial migration
hsa04530  Tight junction
hsa05212  Pancreatic cancer
hsa05416  Viral myocarditis
hsa05131  Shigellosis
hsa04145  Phagosome
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04015  Rap1 signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04360  Axon guidance
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04062  Chemokine signaling pathway
hsa04520  Adherens junction
hsa04010  MAPK signaling pathway
hsa04510  Focal adhesion
hsa05203  Viral carcinogenesis
hsa05418  Fluid shear stress and atherosclerosis
hsa05205  Proteoglycans in cancer
hsa04151  PI3K-Akt signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05200  Pathways in cancer

Diseases

Associated diseases References
Endometriosis INFBASE27041028
Mental retardation, autosomal dominant 48 OMIM602048

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
27041028 Endometrio
sis

106 (62 control
s, 44 endometri
osis)
Rac1
MMP3
ATF-2
SDC4
Show abstract