Endometriosis Knowledgebase

Search Result

Gene id

5919

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

RARRES2 Gene UCSC Ensembl

Aliases

HP10433, TIG2

Gene name

retinoic acid receptor responder 2

Alternate names

retinoic acid receptor responder protein 2, RAR-responsive protein TIG2, chemerin, retinoic acid receptor responder (tazarotene induced) 2, tazarotene-induced gene 2 protein,

Gene location

7q36.1 (150341684: 150338317) Exons: 6 NC_000007.14

Gene summary(Entrez)

This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine and as an antimicrobial protein with activity against bacteria and fungi. [provided by RefSeq, Nov 2014]

OMIM

601973

Protein Summary

Protein general information

Q99969

Name: Retinoic acid receptor responder protein 2 (Chemerin) (RAR responsive protein TIG2) (Tazarotene induced gene 2 protein)

Length: 163 Mass: 18,618

Tissue specificity: Expressed at the highest levels in placenta, liver, and white adipose tissue (WAT), and to a lesser extent in many other tissues such as lung, brown adipose tissue, heart, ovary, kidney, skeletal muscle and pancreas. Within WAT, expres

Sequence

MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQT
SCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYF
PGQFAFSKALPRS

Structural information

Interpro:	IPR029562
STRING:	ENSP00000223271;

Other Databases

GeneCards: RARRES2; Malacards: RARRES2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001523	retinoid metabolic proces s	IDA	biological_process
GO:0001701	in utero embryonic develo pment	IEP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005102	receptor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	ISS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0006935	chemotaxis	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0010759	positive regulation of ma crophage chemotaxis	IMP	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031089	platelet dense granule lu men	TAS	cellular_component
GO:0045600	positive regulation of fa t cell differentiation	ISS	biological_process
GO:0048566	embryonic digestive tract development	IMP	biological_process
GO:0050873	brown fat cell differenti ation	IEA	biological_process
GO:0050921	positive regulation of ch emotaxis	ISS	biological_process
GO:0050994	regulation of lipid catab olic process	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:2001275	positive regulation of gl ucose import in response to insulin stimulus	IDA	biological_process
GO:0001523	retinoid metabolic proces s	IDA	biological_process
GO:0001701	in utero embryonic develo pment	IEP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005102	receptor binding	IEA	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	ISS	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0006935	chemotaxis	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0010759	positive regulation of ma crophage chemotaxis	IMP	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031089	platelet dense granule lu men	TAS	cellular_component
GO:0045600	positive regulation of fa t cell differentiation	IEA	biological_process
GO:0045600	positive regulation of fa t cell differentiation	ISS	biological_process
GO:0048566	embryonic digestive tract development	IMP	biological_process
GO:0050873	brown fat cell differenti ation	IEA	biological_process
GO:0050921	positive regulation of ch emotaxis	IEA	biological_process
GO:0050921	positive regulation of ch emotaxis	ISS	biological_process
GO:0050994	regulation of lipid catab olic process	IEA	biological_process
GO:0050994	regulation of lipid catab olic process	IEA	biological_process
GO:0050994	regulation of lipid catab olic process	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:2001275	positive regulation of gl ucose import in response to insulin stimulus	IEA	biological_process
GO:2001275	positive regulation of gl ucose import in response to insulin stimulus	IDA	biological_process
GO:0001523	retinoid metabolic proces s	IDA	biological_process
GO:0001701	in utero embryonic develo pment	IEP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005102	receptor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	ISS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0010759	positive regulation of ma crophage chemotaxis	IMP	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031089	platelet dense granule lu men	TAS	cellular_component
GO:0045600	positive regulation of fa t cell differentiation	ISS	biological_process
GO:0048566	embryonic digestive tract development	IMP	biological_process
GO:0050921	positive regulation of ch emotaxis	ISS	biological_process
GO:0050994	regulation of lipid catab olic process	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:2001275	positive regulation of gl ucose import in response to insulin stimulus	IDA	biological_process

Diseases

Associated diseases	References
Inflammatory bowel disease	PMID: 17068223
Endometriosis	INFBASE26059828
Ovarian endometriosis	INFBASE18288381
Ovarian endometriosis	PMID: 18288381
Polycystic ovary syndrome (PCOS)	PMID: 24927079

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
18288381	Endometrio sis (ovari an)						Show abstract
26059828	Endometrio sis			79 (31 women wi th endometriosi s, 48 women wit hout endometrio sis)		TNFA IL-6	Show abstract