Endometriosis Knowledgebase

Search Result

Gene id

595

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CCND1 Gene UCSC Ensembl

Aliases

BCL1, D11S287E, PRAD1, U21B31

Gene name

cyclin D1

Alternate names

G1/S-specific cyclin-D1, B-cell CLL/lymphoma 1, B-cell lymphoma 1 protein, BCL-1 oncogene, PRAD1 oncogene,

Gene location

11q13.3 (69641104: 69654473) Exons: 5 NC_000011.10

Gene summary(Entrez)

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with tumor suppressor protein Rb and the expression of this gene is regulated positively by Rb. Mutations, amplification and overexpression of this gene, which alters cell cycle progression, are observed frequently in a variety of tumors and may contribute to tumorigenesis. [provided by RefSeq, Jul 2008]

OMIM

168461

Protein Summary

Protein general information

P24385

Name: G1/S specific cyclin D1 (B cell lymphoma 1 protein) (BCL 1) (BCL 1 oncogene) (PRAD1 oncogene)

Length: 295 Mass: 33,729

Sequence

MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEE
EVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKW
NLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLS
YYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI

Structural information

Protein Domains	Cyclin (28-152)
Interpro:	IPR013763 IPR004367 IPR015451 IPR006671
Prosite:	PS00292
Pfam:	PF02984 PF00134
PDB:	2W96 2W99 2W9F 2W9Z
PDBsum:	2W96 2W99 2W9F 2W9Z
DIP:	123
MINT:	135422
STRING:	ENSP00000227507;

Other Databases

GeneCards: CCND1; Malacards: CCND1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000082	G1/S transition of mitoti c cell cycle	TAS	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IDA	cellular_component
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IDA	cellular_component
GO:0000320	re-entry into mitotic cel l cycle	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005923	bicellular tight junction	IEA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0007595	lactation	IEA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0010039	response to iron ion	IEA	biological_process
GO:0010165	response to X-ray	IEA	biological_process
GO:0010243	response to organonitroge n compound	IEA	biological_process
GO:0010971	positive regulation of G2 /M transition of mitotic cell cycle	IDA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016538	cyclin-dependent protein serine/threonine kinase r egulator activity	IEA	molecular_function
GO:0017053	transcriptional repressor complex	IDA	cellular_component
GO:0017053	transcriptional repressor complex	IDA	cellular_component
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030178	negative regulation of Wn t signaling pathway	IEA	biological_process
GO:0030857	negative regulation of ep ithelial cell differentia tion	IEA	biological_process
GO:0030968	endoplasmic reticulum unf olded protein response	IEA	biological_process
GO:0031571	mitotic G1 DNA damage che ckpoint	IDA	biological_process
GO:0032026	response to magnesium ion	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0033197	response to vitamin E	IEA	biological_process
GO:0033327	Leydig cell differentiati on	IEA	biological_process
GO:0033598	mammary gland epithelial cell proliferation	IEA	biological_process
GO:0033601	positive regulation of ma mmary gland epithelial ce ll proliferation	IEA	biological_process
GO:0042493	response to drug	IEP	biological_process
GO:0042826	histone deacetylase bindi ng	IPI	molecular_function
GO:0044321	response to leptin	IDA	biological_process
GO:0045444	fat cell differentiation	IEA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045737	positive regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IDA	biological_process
GO:0045787	positive regulation of ce ll cycle	TAS	biological_process
GO:0051301	cell division	IEA	biological_process
GO:0051412	response to corticosteron e	IEA	biological_process
GO:0051592	response to calcium ion	IEA	biological_process
GO:0060070	canonical Wnt signaling p athway	IEA	biological_process
GO:0060749	mammary gland alveolus de velopment	IEA	biological_process
GO:0070064	proline-rich region bindi ng	IDA	molecular_function
GO:0070141	response to UV-A	IDA	biological_process
GO:0071157	negative regulation of ce ll cycle arrest	IDA	biological_process
GO:0097421	liver regeneration	IEA	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IEA	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	TAS	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IEA	cellular_component
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IDA	cellular_component
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IDA	cellular_component
GO:0000320	re-entry into mitotic cel l cycle	IEA	biological_process
GO:0001889	liver development	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005923	bicellular tight junction	IEA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0007595	lactation	IEA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010039	response to iron ion	IEA	biological_process
GO:0010165	response to X-ray	IEA	biological_process
GO:0010243	response to organonitroge n compound	IEA	biological_process
GO:0010971	positive regulation of G2 /M transition of mitotic cell cycle	IDA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016055	Wnt signaling pathway	IEA	biological_process
GO:0016301	kinase activity	IEA	molecular_function
GO:0016538	cyclin-dependent protein serine/threonine kinase r egulator activity	IEA	molecular_function
GO:0017053	transcriptional repressor complex	IDA	cellular_component
GO:0017053	transcriptional repressor complex	IDA	cellular_component
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030178	negative regulation of Wn t signaling pathway	IEA	biological_process
GO:0030857	negative regulation of ep ithelial cell differentia tion	IEA	biological_process
GO:0030968	endoplasmic reticulum unf olded protein response	IEA	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0031571	mitotic G1 DNA damage che ckpoint	IDA	biological_process
GO:0032026	response to magnesium ion	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0033197	response to vitamin E	IEA	biological_process
GO:0033327	Leydig cell differentiati on	IEA	biological_process
GO:0033598	mammary gland epithelial cell proliferation	IEA	biological_process
GO:0033601	positive regulation of ma mmary gland epithelial ce ll proliferation	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042493	response to drug	IEP	biological_process
GO:0042826	histone deacetylase bindi ng	IPI	molecular_function
GO:0043627	response to estrogen	IEA	biological_process
GO:0044321	response to leptin	IDA	biological_process
GO:0045444	fat cell differentiation	IEA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045737	positive regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IDA	biological_process
GO:0045787	positive regulation of ce ll cycle	TAS	biological_process
GO:0048545	response to steroid hormo ne	IEA	biological_process
GO:0051301	cell division	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051412	response to corticosteron e	IEA	biological_process
GO:0051592	response to calcium ion	IEA	biological_process
GO:0051726	regulation of cell cycle	IEA	biological_process
GO:0060070	canonical Wnt signaling p athway	IEA	biological_process
GO:0060749	mammary gland alveolus de velopment	IEA	biological_process
GO:0070064	proline-rich region bindi ng	IDA	molecular_function
GO:0070141	response to UV-A	IDA	biological_process
GO:0071157	negative regulation of ce ll cycle arrest	IDA	biological_process
GO:0071310	cellular response to orga nic substance	IEA	biological_process
GO:0097421	liver regeneration	IEA	biological_process
GO:2000045	regulation of G1/S transi tion of mitotic cell cycl e	IEA	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	TAS	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IDA	cellular_component
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IDA	cellular_component
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0010971	positive regulation of G2 /M transition of mitotic cell cycle	IDA	biological_process
GO:0017053	transcriptional repressor complex	IDA	cellular_component
GO:0017053	transcriptional repressor complex	IDA	cellular_component
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0031571	mitotic G1 DNA damage che ckpoint	IDA	biological_process
GO:0042493	response to drug	IEP	biological_process
GO:0042826	histone deacetylase bindi ng	IPI	molecular_function
GO:0044321	response to leptin	IDA	biological_process
GO:0045737	positive regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IDA	biological_process
GO:0045787	positive regulation of ce ll cycle	TAS	biological_process
GO:0070064	proline-rich region bindi ng	IDA	molecular_function
GO:0070141	response to UV-A	IDA	biological_process
GO:0071157	negative regulation of ce ll cycle arrest	IDA	biological_process

KEGG pathways

PTHR10177:SF67  CCKR signaling map
hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05206  MicroRNAs in cancer
hsa05166  HTLV-I infection
hsa05205  Proteoglycans in cancer
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04510  Focal adhesion
hsa05161  Hepatitis B
hsa05224  Breast cancer
hsa04630  Jak-STAT signaling pathway
hsa04068  FoxO signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05203  Viral carcinogenesis
hsa05215  Prostate cancer
hsa01522  Endocrine resistance
hsa05162  Measles
hsa04390  Hippo signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04110  Cell cycle
hsa04371  Apelin signaling pathway
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05212  Pancreatic cancer
hsa04152  AMPK signaling pathway
hsa05222  Small cell lung cancer
hsa04917  Prolactin signaling pathway
hsa05210  Colorectal cancer
PTHR10177:SF67  CCKR signaling map
hsa05219  Bladder cancer
hsa04115  p53 signaling pathway
hsa05214  Glioma
hsa05213  Endometrial cancer
hsa04310  Wnt signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04530  Tight junction
hsa05223  Non-small cell lung cancer
hsa05221  Acute myeloid leukemia
hsa05416  Viral myocarditis
hsa05216  Thyroid cancer
hsa04340  Hedgehog signaling pathway
PTHR10177:SF67  CCKR signaling map
PTHR10177:SF67  CCKR signaling map
PTHR10177:SF67  CCKR signaling map
PTHR10177:SF67  CCKR signaling map
PTHR10177:SF67  CCKR signaling map
PTHR10177:SF67  CCKR signaling map

Diseases

Associated diseases	References
Cancer	KEGG: H00031,
Endometriosis	PMID: 24018808
Endometriosis and adenomyosis	PMID: 16616093
Esophageal cancer	KEGG: H00017
Hairy-cell leukemia	KEGG: H00006
Hyperparathyroidism	PMID: 11902820
Insulin resistance	PMID: 18194492
Laryngeal cancer	KEGG: H00055
Mantle cell lymphoma	KEGG: H01464
Multiple myeloma	KEGG: H00010
Oral cancer	KEGG: H00016
Polycystic ovary syndrome (PCOS)	PMID: 16361289
Endometriosis	INFBASE22884659
Endometriosis and adenomyosis	INFBASE16616093
von Hippel-Lindau syndrome	KEGG: H00559

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
24018808	Endometrio sis	67 ovarian endo metrioid adenoc arcinoma(35 ass ociated with en dometriosis, 32 without endome triosis)	Beta-catenin cyclin D1 BAF250a PTEN p53 WT1	Show abstract
22884659	Endometrio sis	91 (59 patients with endometri osis, 32 contro ls)	c-myc cyclin D1 GREB1	Show abstract
16616093	Endometrio sis and ad enomyosis	56 (25 women wi th endometrioma s, 31 women wit h adenomyosis)	p16 pRb cyclin D1	Show abstract