Endometriosis Knowledgebase

Search Result

Gene id

596

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

BCL2 Gene UCSC Ensembl

Aliases

Bcl-2, PPP1R50

Gene name

BCL2, apoptosis regulator

Alternate names

apoptosis regulator Bcl-2, B-cell CLL/lymphoma 2, protein phosphatase 1, regulatory subunit 50,

Gene location

18q21.33 (63319777: 63123345) Exons: 6 NC_000018.10

Gene summary(Entrez)

This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]

OMIM

151430

Protein Summary

Protein general information

P10415

Name: Apoptosis regulator Bcl 2

Length: 239 Mass: 26,266

Tissue specificity: Expressed in a variety of tissues.

Sequence

MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTP
AAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF
FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLAL
VGACITLGAYLGHK

Structural information

Motifs	BH4 (10-30) BH3 (93-107) BH1 (136-155) BH2. (187-202)
Interpro:	IPR013278 IPR002475 IPR004725 IPR020717 IPR020726 IPR020728 IPR003093 IPR020731 IPR026298
Prosite:	PS50062 PS01080 PS01258 PS01259 PS01260 PS50063
Pfam:	PF00452 PF02180
PDB:	1G5M 1GJH 1YSW 2O21 2O22 2O2F 2W3L 2XA0 4AQ3 4IEH 4LVT 4LXD 4MAN 5AGW 5AGX 5FCG 5JSN
PDBsum:	1G5M 1GJH 1YSW 2O21 2O22 2O2F 2W3L 2XA0 4AQ3 4IEH 4LVT 4LXD 4MAN 5AGW 5AGX 5FCG 5JSN
DIP:	1043
MINT:	87089
STRING:	ENSP00000329623;

Other Databases

GeneCards: BCL2; Malacards: BCL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000209	protein polyubiquitinatio n	IDA	biological_process
GO:0001503	ossification	IEA	biological_process
GO:0001541	ovarian follicle developm ent	IEA	biological_process
GO:0001656	metanephros development	IEA	biological_process
GO:0001658	branching involved in ure teric bud morphogenesis	IEA	biological_process
GO:0001662	behavioral fear response	IEA	biological_process
GO:0001782	B cell homeostasis	IEA	biological_process
GO:0001836	release of cytochrome c f rom mitochondria	NAS	biological_process
GO:0001836	release of cytochrome c f rom mitochondria	ISS	biological_process
GO:0001952	regulation of cell-matrix adhesion	IEA	biological_process
GO:0002020	protease binding	IDA	molecular_function
GO:0002320	lymphoid progenitor cell differentiation	IEA	biological_process
GO:0002326	B cell lineage commitment	IEA	biological_process
GO:0002931	response to ischemia	IEA	biological_process
GO:0003014	renal system process	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006470	protein dephosphorylation	IEA	biological_process
GO:0006582	melanin metabolic process	IEA	biological_process
GO:0006808	regulation of nitrogen ut ilization	IEA	biological_process
GO:0006915	apoptotic process	IDA	biological_process
GO:0006915	apoptotic process	IDA	biological_process
GO:0006959	humoral immune response	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0007015	actin filament organizati on	IEA	biological_process
GO:0007409	axonogenesis	IEA	biological_process
GO:0007565	female pregnancy	NAS	biological_process
GO:0007569	cell aging	IEA	biological_process
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0008584	male gonad development	IEA	biological_process
GO:0008625	extrinsic apoptotic signa ling pathway via death do main receptors	IDA	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IBA	biological_process
GO:0008631	intrinsic apoptotic signa ling pathway in response to oxidative stress	IEA	biological_process
GO:0009314	response to radiation	NAS	biological_process
GO:0009636	response to toxic substan ce	IDA	biological_process
GO:0009636	response to toxic substan ce	IDA	biological_process
GO:0009791	post-embryonic developmen t	IEA	biological_process
GO:0010039	response to iron ion	IDA	biological_process
GO:0010224	response to UV-B	IEA	biological_process
GO:0010332	response to gamma radiati on	IEA	biological_process
GO:0010468	regulation of gene expres sion	IEA	biological_process
GO:0010507	negative regulation of au tophagy	TAS	biological_process
GO:0010523	negative regulation of ca lcium ion transport into cytosol	IEA	biological_process
GO:0010559	regulation of glycoprotei n biosynthetic process	IEA	biological_process
GO:0014031	mesenchymal cell developm ent	IEA	biological_process
GO:0014042	positive regulation of ne uron maturation	IEA	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IEA	biological_process
GO:0015267	channel activity	IDA	molecular_function
GO:0016020	membrane	IDA	cellular_component
GO:0016049	cell growth	IEA	biological_process
GO:0016248	channel inhibitor activit y	IDA	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IEA	biological_process
GO:0018107	peptidyl-threonine phosph orylation	IEA	biological_process
GO:0021747	cochlear nucleus developm ent	IEA	biological_process
GO:0022612	gland morphogenesis	IEA	biological_process
GO:0022898	regulation of transmembra ne transporter activity	IDA	biological_process
GO:0030279	negative regulation of os sification	IEA	biological_process
GO:0030307	positive regulation of ce ll growth	IDA	biological_process
GO:0030308	negative regulation of ce ll growth	IEA	biological_process
GO:0030318	melanocyte differentiatio n	IEA	biological_process
GO:0030336	negative regulation of ce ll migration	IEA	biological_process
GO:0030890	positive regulation of B cell proliferation	IMP	biological_process
GO:0031069	hair follicle morphogenes is	IEA	biological_process
GO:0031103	axon regeneration	IEA	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0031647	regulation of protein sta bility	IEA	biological_process
GO:0031965	nuclear membrane	IDA	cellular_component
GO:0031965	nuclear membrane	IDA	cellular_component
GO:0031965	nuclear membrane	IDA	cellular_component
GO:0031965	nuclear membrane	IDA	cellular_component
GO:0032469	endoplasmic reticulum cal cium ion homeostasis	TAS	biological_process
GO:0032835	glomerulus development	IEA	biological_process
GO:0032848	negative regulation of ce llular pH reduction	IDA	biological_process
GO:0033033	negative regulation of my eloid cell apoptotic proc ess	IEA	biological_process
GO:0033077	T cell differentiation in thymus	IEA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IEA	biological_process
GO:0033689	negative regulation of os teoblast proliferation	IEA	biological_process
GO:0034097	response to cytokine	IDA	biological_process
GO:0035094	response to nicotine	IDA	biological_process
GO:0035265	organ growth	IEA	biological_process
GO:0040018	positive regulation of mu lticellular organism grow th	IEA	biological_process
GO:0042100	B cell proliferation	IDA	biological_process
GO:0042149	cellular response to gluc ose starvation	IEA	biological_process
GO:0042493	response to drug	IMP	biological_process
GO:0042493	response to drug	IDA	biological_process
GO:0042542	response to hydrogen pero xide	IEA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043029	T cell homeostasis	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IGI	biological_process
GO:0043085	positive regulation of ca talytic activity	IEA	biological_process
GO:0043209	myelin sheath	IEA	cellular_component
GO:0043375	CD8-positive, alpha-beta T cell lineage commitment	IEA	biological_process
GO:0043496	regulation of protein hom odimerization activity	IDA	biological_process
GO:0043497	regulation of protein het erodimerization activity	IDA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IDA	biological_process
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0043583	ear development	IEA	biological_process
GO:0045069	regulation of viral genom e replication	IEA	biological_process
GO:0045636	positive regulation of me lanocyte differentiation	IEA	biological_process
GO:0046671	negative regulation of re tinal cell programmed cel l death	IEA	biological_process
GO:0046902	regulation of mitochondri al membrane permeability	ISS	biological_process
GO:0046930	pore complex	IDA	cellular_component
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0048041	focal adhesion assembly	IEA	biological_process
GO:0048536	spleen development	IEA	biological_process
GO:0048538	thymus development	IEA	biological_process
GO:0048546	digestive tract morphogen esis	IEA	biological_process
GO:0048599	oocyte development	IEA	biological_process
GO:0048743	positive regulation of sk eletal muscle fiber devel opment	IEA	biological_process
GO:0048753	pigment granule organizat ion	IEA	biological_process
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological_process
GO:0050853	B cell receptor signaling pathway	IMP	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051402	neuron apoptotic process	TAS	biological_process
GO:0051434	BH3 domain binding	IPI	molecular_function
GO:0051607	defense response to virus	IDA	biological_process
GO:0051721	protein phosphatase 2A bi nding	IEA	molecular_function
GO:0051881	regulation of mitochondri al membrane potential	ISS	biological_process
GO:0051902	negative regulation of mi tochondrial depolarizatio n	TAS	biological_process
GO:0051924	regulation of calcium ion transport	IDA	biological_process
GO:0055085	transmembrane transport	IEA	biological_process
GO:0070059	intrinsic apoptotic signa ling pathway in response to endoplasmic reticulum stress	IDA	biological_process
GO:0071310	cellular response to orga nic substance	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0072593	reactive oxygen species m etabolic process	IEA	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	IEA	biological_process
GO:1900740	positive regulation of pr otein insertion into mito chondrial membrane involv ed in apoptotic signaling pathway	TAS	biological_process
GO:2000134	negative regulation of G1 /S transition of mitotic cell cycle	IEA	biological_process
GO:2000378	negative regulation of re active oxygen species met abolic process	IEA	biological_process
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:2001234	negative regulation of ap optotic signaling pathway	IMP	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	IGI	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IDA	biological_process
GO:2001244	positive regulation of in trinsic apoptotic signali ng pathway	TAS	biological_process
GO:0000209	protein polyubiquitinatio n	IDA	biological_process
GO:0000902	cell morphogenesis	IEA	biological_process
GO:0001503	ossification	IEA	biological_process
GO:0001541	ovarian follicle developm ent	IEA	biological_process
GO:0001656	metanephros development	IEA	biological_process
GO:0001657	ureteric bud development	IEA	biological_process
GO:0001658	branching involved in ure teric bud morphogenesis	IEA	biological_process
GO:0001662	behavioral fear response	IEA	biological_process
GO:0001776	leukocyte homeostasis	IEA	biological_process
GO:0001782	B cell homeostasis	IEA	biological_process
GO:0001822	kidney development	IEA	biological_process
GO:0001836	release of cytochrome c f rom mitochondria	IEA	biological_process
GO:0001836	release of cytochrome c f rom mitochondria	NAS	biological_process
GO:0001836	release of cytochrome c f rom mitochondria	ISS	biological_process
GO:0001952	regulation of cell-matrix adhesion	IEA	biological_process
GO:0002020	protease binding	IDA	molecular_function
GO:0002260	lymphocyte homeostasis	IEA	biological_process
GO:0002320	lymphoid progenitor cell differentiation	IEA	biological_process
GO:0002326	B cell lineage commitment	IEA	biological_process
GO:0002360	T cell lineage commitment	IEA	biological_process
GO:0002520	immune system development	IEA	biological_process
GO:0002931	response to ischemia	IEA	biological_process
GO:0003014	renal system process	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	IEA	cellular_component
GO:0005741	mitochondrial outer membr ane	IEA	cellular_component
GO:0005741	mitochondrial outer membr ane	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006470	protein dephosphorylation	IEA	biological_process
GO:0006582	melanin metabolic process	IEA	biological_process
GO:0006808	regulation of nitrogen ut ilization	IEA	biological_process
GO:0006874	cellular calcium ion home ostasis	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006915	apoptotic process	IDA	biological_process
GO:0006915	apoptotic process	IDA	biological_process
GO:0006959	humoral immune response	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0007015	actin filament organizati on	IEA	biological_process
GO:0007409	axonogenesis	IEA	biological_process
GO:0007565	female pregnancy	NAS	biological_process
GO:0007569	cell aging	IEA	biological_process
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0008283	cell proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0008584	male gonad development	IEA	biological_process
GO:0008625	extrinsic apoptotic signa ling pathway via death do main receptors	IDA	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IBA	biological_process
GO:0008631	intrinsic apoptotic signa ling pathway in response to oxidative stress	IEA	biological_process
GO:0008637	apoptotic mitochondrial c hanges	IEA	biological_process
GO:0009314	response to radiation	NAS	biological_process
GO:0009636	response to toxic substan ce	IEA	biological_process
GO:0009636	response to toxic substan ce	IDA	biological_process
GO:0009636	response to toxic substan ce	IDA	biological_process
GO:0009791	post-embryonic developmen t	IEA	biological_process
GO:0009887	animal organ morphogenesi s	IEA	biological_process
GO:0010039	response to iron ion	IDA	biological_process
GO:0010224	response to UV-B	IEA	biological_process
GO:0010332	response to gamma radiati on	IEA	biological_process
GO:0010468	regulation of gene expres sion	IEA	biological_process
GO:0010506	regulation of autophagy	IEA	biological_process
GO:0010507	negative regulation of au tophagy	IEA	biological_process
GO:0010507	negative regulation of au tophagy	TAS	biological_process
GO:0010523	negative regulation of ca lcium ion transport into cytosol	IEA	biological_process
GO:0010559	regulation of glycoprotei n biosynthetic process	IEA	biological_process
GO:0014031	mesenchymal cell developm ent	IEA	biological_process
GO:0014042	positive regulation of ne uron maturation	IEA	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IEA	biological_process
GO:0015267	channel activity	IDA	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016049	cell growth	IEA	biological_process
GO:0016248	channel inhibitor activit y	IDA	molecular_function
GO:0016337	single organismal cell-ce ll adhesion	IEA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IEA	biological_process
GO:0018107	peptidyl-threonine phosph orylation	IEA	biological_process
GO:0019903	protein phosphatase bindi ng	IEA	molecular_function
GO:0021747	cochlear nucleus developm ent	IEA	biological_process
GO:0022612	gland morphogenesis	IEA	biological_process
GO:0022898	regulation of transmembra ne transporter activity	IDA	biological_process
GO:0030097	hemopoiesis	IEA	biological_process
GO:0030183	B cell differentiation	IEA	biological_process
GO:0030217	T cell differentiation	IEA	biological_process
GO:0030279	negative regulation of os sification	IEA	biological_process
GO:0030307	positive regulation of ce ll growth	IDA	biological_process
GO:0030308	negative regulation of ce ll growth	IEA	biological_process
GO:0030318	melanocyte differentiatio n	IEA	biological_process
GO:0030336	negative regulation of ce ll migration	IEA	biological_process
GO:0030890	positive regulation of B cell proliferation	IMP	biological_process
GO:0031069	hair follicle morphogenes is	IEA	biological_process
GO:0031103	axon regeneration	IEA	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0031647	regulation of protein sta bility	IEA	biological_process
GO:0031965	nuclear membrane	IEA	cellular_component
GO:0031965	nuclear membrane	IEA	cellular_component
GO:0031965	nuclear membrane	IDA	cellular_component
GO:0031965	nuclear membrane	IDA	cellular_component
GO:0031965	nuclear membrane	IDA	cellular_component
GO:0031965	nuclear membrane	IDA	cellular_component
GO:0031966	mitochondrial membrane	IEA	cellular_component
GO:0032469	endoplasmic reticulum cal cium ion homeostasis	IEA	biological_process
GO:0032469	endoplasmic reticulum cal cium ion homeostasis	TAS	biological_process
GO:0032835	glomerulus development	IEA	biological_process
GO:0032848	negative regulation of ce llular pH reduction	IDA	biological_process
GO:0032880	regulation of protein loc alization	IEA	biological_process
GO:0033033	negative regulation of my eloid cell apoptotic proc ess	IEA	biological_process
GO:0033077	T cell differentiation in thymus	IEA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IEA	biological_process
GO:0033689	negative regulation of os teoblast proliferation	IEA	biological_process
GO:0034097	response to cytokine	IEA	biological_process
GO:0034097	response to cytokine	IDA	biological_process
GO:0035094	response to nicotine	IDA	biological_process
GO:0035265	organ growth	IEA	biological_process
GO:0040007	growth	IEA	biological_process
GO:0040018	positive regulation of mu lticellular organism grow th	IEA	biological_process
GO:0042100	B cell proliferation	IDA	biological_process
GO:0042149	cellular response to gluc ose starvation	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042493	response to drug	IMP	biological_process
GO:0042493	response to drug	IDA	biological_process
GO:0042542	response to hydrogen pero xide	IEA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0042981	regulation of apoptotic p rocess	IEA	biological_process
GO:0042981	regulation of apoptotic p rocess	IEA	biological_process
GO:0043029	T cell homeostasis	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IGI	biological_process
GO:0043067	regulation of programmed cell death	IEA	biological_process
GO:0043085	positive regulation of ca talytic activity	IEA	biological_process
GO:0043209	myelin sheath	IEA	cellular_component
GO:0043375	CD8-positive, alpha-beta T cell lineage commitment	IEA	biological_process
GO:0043473	pigmentation	IEA	biological_process
GO:0043496	regulation of protein hom odimerization activity	IDA	biological_process
GO:0043497	regulation of protein het erodimerization activity	IDA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IDA	biological_process
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0043583	ear development	IEA	biological_process
GO:0045069	regulation of viral genom e replication	IEA	biological_process
GO:0045636	positive regulation of me lanocyte differentiation	IEA	biological_process
GO:0045930	negative regulation of mi totic cell cycle	IEA	biological_process
GO:0046671	negative regulation of re tinal cell programmed cel l death	IEA	biological_process
GO:0046902	regulation of mitochondri al membrane permeability	IEA	biological_process
GO:0046902	regulation of mitochondri al membrane permeability	ISS	biological_process
GO:0046930	pore complex	IDA	cellular_component
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0048041	focal adhesion assembly	IEA	biological_process
GO:0048066	developmental pigmentatio n	IEA	biological_process
GO:0048070	regulation of development al pigmentation	IEA	biological_process
GO:0048087	positive regulation of de velopmental pigmentation	IEA	biological_process
GO:0048536	spleen development	IEA	biological_process
GO:0048538	thymus development	IEA	biological_process
GO:0048545	response to steroid hormo ne	IEA	biological_process
GO:0048546	digestive tract morphogen esis	IEA	biological_process
GO:0048589	developmental growth	IEA	biological_process
GO:0048599	oocyte development	IEA	biological_process
GO:0048743	positive regulation of sk eletal muscle fiber devel opment	IEA	biological_process
GO:0048753	pigment granule organizat ion	IEA	biological_process
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological_process
GO:0050790	regulation of catalytic a ctivity	IEA	biological_process
GO:0050853	B cell receptor signaling pathway	IMP	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051402	neuron apoptotic process	IEA	biological_process
GO:0051402	neuron apoptotic process	TAS	biological_process
GO:0051434	BH3 domain binding	IPI	molecular_function
GO:0051607	defense response to virus	IDA	biological_process
GO:0051721	protein phosphatase 2A bi nding	IEA	molecular_function
GO:0051726	regulation of cell cycle	IEA	biological_process
GO:0051881	regulation of mitochondri al membrane potential	IEA	biological_process
GO:0051881	regulation of mitochondri al membrane potential	ISS	biological_process
GO:0051902	negative regulation of mi tochondrial depolarizatio n	TAS	biological_process
GO:0051924	regulation of calcium ion transport	IDA	biological_process
GO:0055085	transmembrane transport	IEA	biological_process
GO:0070059	intrinsic apoptotic signa ling pathway in response to endoplasmic reticulum stress	IDA	biological_process
GO:0071310	cellular response to orga nic substance	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0072593	reactive oxygen species m etabolic process	IEA	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	IEA	biological_process
GO:1900740	positive regulation of pr otein insertion into mito chondrial membrane involv ed in apoptotic signaling pathway	TAS	biological_process
GO:2000134	negative regulation of G1 /S transition of mitotic cell cycle	IEA	biological_process
GO:2000378	negative regulation of re active oxygen species met abolic process	IEA	biological_process
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:2001234	negative regulation of ap optotic signaling pathway	IEA	biological_process
GO:2001234	negative regulation of ap optotic signaling pathway	IMP	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	IGI	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IDA	biological_process
GO:2001244	positive regulation of in trinsic apoptotic signali ng pathway	TAS	biological_process
GO:0000209	protein polyubiquitinatio n	IDA	biological_process
GO:0001836	release of cytochrome c f rom mitochondria	NAS	biological_process
GO:0001836	release of cytochrome c f rom mitochondria	ISS	biological_process
GO:0002020	protease binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0006915	apoptotic process	IDA	biological_process
GO:0006915	apoptotic process	IDA	biological_process
GO:0006959	humoral immune response	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0007565	female pregnancy	NAS	biological_process
GO:0008625	extrinsic apoptotic signa ling pathway via death do main receptors	IDA	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IBA	biological_process
GO:0009314	response to radiation	NAS	biological_process
GO:0009636	response to toxic substan ce	IDA	biological_process
GO:0009636	response to toxic substan ce	IDA	biological_process
GO:0010039	response to iron ion	IDA	biological_process
GO:0010507	negative regulation of au tophagy	TAS	biological_process
GO:0015267	channel activity	IDA	molecular_function
GO:0016020	membrane	IDA	cellular_component
GO:0016248	channel inhibitor activit y	IDA	molecular_function
GO:0022898	regulation of transmembra ne transporter activity	IDA	biological_process
GO:0030307	positive regulation of ce ll growth	IDA	biological_process
GO:0030890	positive regulation of B cell proliferation	IMP	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0031965	nuclear membrane	IDA	cellular_component
GO:0031965	nuclear membrane	IDA	cellular_component
GO:0031965	nuclear membrane	IDA	cellular_component
GO:0031965	nuclear membrane	IDA	cellular_component
GO:0032469	endoplasmic reticulum cal cium ion homeostasis	TAS	biological_process
GO:0032848	negative regulation of ce llular pH reduction	IDA	biological_process
GO:0034097	response to cytokine	IDA	biological_process
GO:0035094	response to nicotine	IDA	biological_process
GO:0042100	B cell proliferation	IDA	biological_process
GO:0042493	response to drug	IMP	biological_process
GO:0042493	response to drug	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IGI	biological_process
GO:0043496	regulation of protein hom odimerization activity	IDA	biological_process
GO:0043497	regulation of protein het erodimerization activity	IDA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IDA	biological_process
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0046902	regulation of mitochondri al membrane permeability	ISS	biological_process
GO:0046930	pore complex	IDA	cellular_component
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0050853	B cell receptor signaling pathway	IMP	biological_process
GO:0051402	neuron apoptotic process	TAS	biological_process
GO:0051434	BH3 domain binding	IPI	molecular_function
GO:0051607	defense response to virus	IDA	biological_process
GO:0051881	regulation of mitochondri al membrane potential	ISS	biological_process
GO:0051902	negative regulation of mi tochondrial depolarizatio n	TAS	biological_process
GO:0051924	regulation of calcium ion transport	IDA	biological_process
GO:0070059	intrinsic apoptotic signa ling pathway in response to endoplasmic reticulum stress	IDA	biological_process
GO:1900740	positive regulation of pr otein insertion into mito chondrial membrane involv ed in apoptotic signaling pathway	TAS	biological_process
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:2001234	negative regulation of ap optotic signaling pathway	IMP	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	IGI	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IDA	biological_process
GO:2001244	positive regulation of in trinsic apoptotic signali ng pathway	TAS	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05206  MicroRNAs in cancer
hsa04510  Focal adhesion
hsa05152  Tuberculosis
hsa05169  Epstein-Barr virus infection
hsa05418  Fluid shear stress and atherosclerosis
hsa05161  Hepatitis B
hsa04630  Jak-STAT signaling pathway
hsa05145  Toxoplasmosis
PTHR11256:SF11  CCKR signaling map
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04210  Apoptosis
hsa04621  NOD-like receptor signaling pathway
hsa05215  Prostate cancer
hsa01522  Endocrine resistance
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04066  HIF-1 signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04217  Necroptosis
hsa01524  Platinum drug resistance
hsa05222  Small cell lung cancer
hsa05210  Colorectal cancer
hsa04064  NF-kappa B signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04725  Cholinergic synapse
hsa04215  Apoptosis
hsa05014  Amyotrophic lateral sclerosis
hsa04340  Hedgehog signaling pathway
PTHR11256:SF11  CCKR signaling map
PTHR11256:SF11  CCKR signaling map
PTHR11256:SF11  CCKR signaling map
PTHR11256:SF11  CCKR signaling map
PTHR11256:SF11  CCKR signaling map

Diseases

Associated diseases	References
Adenomyosis	PMID: 12212116
Azoospermia	PMID: 26056927
Cancer	PMID: 16733517
Cervical cancer	KEGG: H00030
Choriocarcinoma	KEGG: H00028
Chronic endometritis	PMID: 23351011
Chronic lymphocytic leukemia	KEGG: H00005
Chronic obstructive pulmonary disease (COPD)	PMID: 17207023
Diabetes	PMID: 11704806
Endometrial cancer	PMID: 16361289
Endometriosis	PMID: 19112572
Follicular lymphoma	KEGG: H01613
Gastric cancer	KEGG: H00018
Hyperandrogenism	PMID: 24161766
Kaposi's sarcoma	KEGG: H00041
Male infertility	PMID: 18003625
Multiple sclerosis	PMID: 12161031
Nasopharyngeal cancer	KEGG: H00054
Non-obstructive azoospermia (NOA)	PMID: 24549219
Oocyte competency	PMID: 20034411
Ovarian endometriosis	PMID: 18849443
Ovarian endometriosis	PMID: 18849443
Polycystic ovary syndrome (PCOS)	PMID: 16361289
Recurrent miscarriage	PMID: 23218678
Small cell lung cancer	KEGG: H00013
Systemic lupus erythematosus	PMID: 12133517
Ovarian endometriosis	INFBASE18849443
Adenomyosis	INFBASE12934347
Ectopic endometriosis	INFBASE9065182
Endometriosis	INFBASE9043920
Unexplained infertility	PMID: 16139338
Varicocele	PMID: 25168538

PubMed references

PMID	Condition	Ethnicity	Population details	Associated_genes	Abstract
18849443	Endometrio sis (ovari an)			CYP1A1 CYP1B1 gamma-syn ER alpha ER beta BCL-2	Show abstract
25912412	Endometrio sis		179 (59 endomet rioid cancers, 36 clear cell c ases, 18 contig uous endometrio sis cases, 66 b enign endometri otic ovarian cy sts)	BAF250a AKT ?H2AX BIM BAX ATM CHK2 Bcl2	Show abstract
9065182	Endometrio sis		38 (29 patients with endometri osis, 9 patient s with uterine myoma)	Bcl-2 Fas	Show abstract
9043920	Endometrio sis				Show abstract
22563025	Endometrio sis			CXCL8 CXCR1 PTEN AKT	Show abstract
25996258	Endometrio sis		42 (30 women wi th ovarian endo metriosis, 12 w omen without EM S)	CD147 Bcl-2 ERK	Show abstract
12934347	Endometrio sis		45 (16 patients with adenomyos is, 12 ovarian endometriosis, and 17 normal e ndometrum)	Bcl-2 Bax	Show abstract
16202314	Endometrio sis		66 (36 samples of peritoneal f luid and serum respectively fr om patients wit h endometriosis , 30 samples of peritoneal flu id and serum re spectively from patients witho ut endometriosi s)	PGE2 Bcl-2	Show abstract
11020520	Endometrio sis		30 (14 with unt reated endometr iosis, 16 contr ols)	Bcl-2 Bax	Show abstract
9886539	Endometrio sis		75 (302 women w ith endometrios is, 15 adenomyo sis cases, 30 c ontrol endometr ium)	BCL-2	Show abstract
24127964	Endometrio sis	Caucasi an	30 women in rep roductive age w ith a clinical or sonographic suspicion of en dometrioma	Bcl-2 Bax and Mcl-1	Show abstract