Endometriosis Knowledgebase

Search Result

Gene id

5970

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

RELA Gene UCSC Ensembl

Aliases

NFKB3, p65

Gene name

RELA proto-oncogene, NF-kB subunit

Alternate names

transcription factor p65, NF-kappa-B p65delta3, NF-kappa-B transcription factor p65, nuclear factor NF-kappa-B p65 subunit, nuclear factor of kappa light polypeptide gene enhancer in B-cells 3, v-rel avian reticuloendotheliosis viral oncogene homolog A, v-rel r,

Gene location

11q13.1 (65662971: 65653595) Exons: 11 NC_000011.10

Gene summary(Entrez)

NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

OMIM

164014

Protein Summary

Protein general information

Q04206

Name: Transcription factor p65 (Nuclear factor NF kappa B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B cells 3)

Length: 551 Mass: 60,219

Sequence

MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRIS
LVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRG
DYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIE
VYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQ
ASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDL
GALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPN
GLLSGDEDFSSIADMDFSALLSQISS

Structural information

Protein Domains	RHD. (19-306)
Motifs	Nuclear localization(301-304) 9aaTAD. (536-544)
Interpro:	IPR013783 IPR014756 IPR002909 IPR033926 IPR000451 IPR008967 IPR030495 IPR030492 IPR032397 IPR011539
Prosite:	PS01204 PS50254
Pfam:	PF16179 PF00554
CDD:	cd01177
PDB:	1NFI 2LSP 2O61 3GUT 3QXY 3RC0 4KV1 4KV4 5URN
PDBsum:	1NFI 2LSP 2O61 3GUT 3QXY 3RC0 4KV1 4KV4 5URN
DIP:	24238
MINT:	106444
STRING:	ENSP00000384273;

Other Databases

GeneCards: RELA; Malacards: RELA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IDA	molecular_function
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IDA	molecular_function
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0000980	RNA polymerase II distal enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0001078	transcriptional repressor activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0001205	transcriptional activator activity, RNA polymerase II distal enhancer seque nce-specific binding	IDA	molecular_function
GO:0001889	liver development	IEA	biological_process
GO:0001942	hair follicle development	IEA	biological_process
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0003677	DNA binding	IDA	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003677	DNA binding	IMP	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003682	chromatin binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006117	acetaldehyde metabolic pr ocess	IEA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006968	cellular defense response	NAS	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0009887	animal organ morphogenesi s	IEA	biological_process
GO:0010033	response to organic subst ance	IDA	biological_process
GO:0010224	response to UV-B	IDA	biological_process
GO:0014040	positive regulation of Sc hwann cell differentiatio n	IEA	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0031293	membrane protein intracel lular domain proteolysis	TAS	biological_process
GO:0031490	chromatin DNA binding	IDA	molecular_function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032332	positive regulation of ch ondrocyte differentiation	IEA	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0032481	positive regulation of ty pe I interferon productio n	TAS	biological_process
GO:0032495	response to muramyl dipep tide	IEA	biological_process
GO:0032570	response to progesterone	IEA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0033256	I-kappaB/NF-kappaB comple x	IBA	cellular_component
GO:0033590	response to cobalamin	IEA	biological_process
GO:0033613	activating transcription factor binding	IPI	molecular_function
GO:0035729	cellular response to hepa tocyte growth factor stim ulus	IEA	biological_process
GO:0035994	response to muscle stretc h	IEA	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0042177	negative regulation of pr otein catabolic process	IEA	biological_process
GO:0042301	phosphate ion binding	IDA	molecular_function
GO:0042493	response to drug	IEA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IDA	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0042805	actinin binding	IPI	molecular_function
GO:0042826	histone deacetylase bindi ng	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEP	biological_process
GO:0043200	response to amino acid	IEA	biological_process
GO:0043278	response to morphine	IEA	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045084	positive regulation of in terleukin-12 biosynthetic process	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046627	negative regulation of in sulin receptor signaling pathway	IEA	biological_process
GO:0046982	protein heterodimerizatio n activity	IDA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IDA	molecular_function
GO:0047485	protein N-terminus bindin g	IPI	molecular_function
GO:0050727	regulation of inflammator y response	ISS	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0051059	NF-kappaB binding	IPI	molecular_function
GO:0051059	NF-kappaB binding	IPI	molecular_function
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	TAS	biological_process
GO:0051591	response to cAMP	IEA	biological_process
GO:0051607	defense response to virus	NAS	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IDA	biological_process
GO:0070431	nucleotide-binding oligom erization domain containi ng 2 signaling pathway	IDA	biological_process
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0070555	response to interleukin-1	IGI	biological_process
GO:0071159	NF-kappaB complex	IEA	cellular_component
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071316	cellular response to nico tine	IMP	biological_process
GO:0071347	cellular response to inte rleukin-1	IDA	biological_process
GO:0071354	cellular response to inte rleukin-6	IMP	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IDA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IDA	biological_process
GO:0071375	cellular response to pept ide hormone stimulus	IMP	biological_process
GO:0071532	ankyrin repeat binding	IEA	molecular_function
GO:1901223	negative regulation of NI K/NF-kappaB signaling	IMP	biological_process
GO:2000630	positive regulation of mi RNA metabolic process	IMP	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IEA	molecular_function
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IDA	molecular_function
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IDA	molecular_function
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0000980	RNA polymerase II distal enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0001078	transcriptional repressor activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0001205	transcriptional activator activity, RNA polymerase II distal enhancer seque nce-specific binding	IDA	molecular_function
GO:0001889	liver development	IEA	biological_process
GO:0001942	hair follicle development	IEA	biological_process
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003677	DNA binding	IMP	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003682	chromatin binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IEA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006117	acetaldehyde metabolic pr ocess	IEA	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0006952	defense response	IEA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006968	cellular defense response	NAS	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0009617	response to bacterium	IEA	biological_process
GO:0009887	animal organ morphogenesi s	IEA	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010033	response to organic subst ance	IDA	biological_process
GO:0010035	response to inorganic sub stance	IEA	biological_process
GO:0010224	response to UV-B	IDA	biological_process
GO:0014040	positive regulation of Sc hwann cell differentiatio n	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0019899	enzyme binding	IEA	molecular_function
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0031293	membrane protein intracel lular domain proteolysis	TAS	biological_process
GO:0031490	chromatin DNA binding	IDA	molecular_function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032332	positive regulation of ch ondrocyte differentiation	IEA	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0032481	positive regulation of ty pe I interferon productio n	TAS	biological_process
GO:0032495	response to muramyl dipep tide	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032570	response to progesterone	IEA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0033256	I-kappaB/NF-kappaB comple x	IBA	cellular_component
GO:0033590	response to cobalamin	IEA	biological_process
GO:0033613	activating transcription factor binding	IPI	molecular_function
GO:0034097	response to cytokine	IEA	biological_process
GO:0035729	cellular response to hepa tocyte growth factor stim ulus	IEA	biological_process
GO:0035994	response to muscle stretc h	IEA	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0042177	negative regulation of pr otein catabolic process	IEA	biological_process
GO:0042301	phosphate ion binding	IDA	molecular_function
GO:0042493	response to drug	IEA	biological_process
GO:0042542	response to hydrogen pero xide	IEA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IDA	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0042805	actinin binding	IEA	molecular_function
GO:0042805	actinin binding	IPI	molecular_function
GO:0042826	histone deacetylase bindi ng	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEP	biological_process
GO:0043200	response to amino acid	IEA	biological_process
GO:0043234	protein complex	IEA	cellular_component
GO:0043278	response to morphine	IEA	biological_process
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045084	positive regulation of in terleukin-12 biosynthetic process	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046627	negative regulation of in sulin receptor signaling pathway	IEA	biological_process
GO:0046982	protein heterodimerizatio n activity	IDA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IDA	molecular_function
GO:0047485	protein N-terminus bindin g	IPI	molecular_function
GO:0050727	regulation of inflammator y response	IEA	biological_process
GO:0050727	regulation of inflammator y response	ISS	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0051059	NF-kappaB binding	IPI	molecular_function
GO:0051059	NF-kappaB binding	IPI	molecular_function
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	TAS	biological_process
GO:0051591	response to cAMP	IEA	biological_process
GO:0051607	defense response to virus	NAS	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IDA	biological_process
GO:0070431	nucleotide-binding oligom erization domain containi ng 2 signaling pathway	IDA	biological_process
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0070555	response to interleukin-1	IGI	biological_process
GO:0071159	NF-kappaB complex	IEA	cellular_component
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071316	cellular response to nico tine	IMP	biological_process
GO:0071347	cellular response to inte rleukin-1	IDA	biological_process
GO:0071354	cellular response to inte rleukin-6	IMP	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IDA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IDA	biological_process
GO:0071375	cellular response to pept ide hormone stimulus	IMP	biological_process
GO:0071532	ankyrin repeat binding	IEA	molecular_function
GO:1901223	negative regulation of NI K/NF-kappaB signaling	IMP	biological_process
GO:2000630	positive regulation of mi RNA metabolic process	IMP	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IEA	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IDA	molecular_function
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IDA	molecular_function
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0000980	RNA polymerase II distal enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0001078	transcriptional repressor activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0001205	transcriptional activator activity, RNA polymerase II distal enhancer seque nce-specific binding	IDA	molecular_function
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0003677	DNA binding	IDA	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003677	DNA binding	IMP	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003682	chromatin binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006954	inflammatory response	IDA	biological_process
GO:0006968	cellular defense response	NAS	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0010033	response to organic subst ance	IDA	biological_process
GO:0010224	response to UV-B	IDA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0031293	membrane protein intracel lular domain proteolysis	TAS	biological_process
GO:0031490	chromatin DNA binding	IDA	molecular_function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032481	positive regulation of ty pe I interferon productio n	TAS	biological_process
GO:0033256	I-kappaB/NF-kappaB comple x	IBA	cellular_component
GO:0033613	activating transcription factor binding	IPI	molecular_function
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0042301	phosphate ion binding	IDA	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IDA	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0042805	actinin binding	IPI	molecular_function
GO:0042826	histone deacetylase bindi ng	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEP	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IDA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IDA	molecular_function
GO:0047485	protein N-terminus bindin g	IPI	molecular_function
GO:0050727	regulation of inflammator y response	ISS	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0051059	NF-kappaB binding	IPI	molecular_function
GO:0051059	NF-kappaB binding	IPI	molecular_function
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	TAS	biological_process
GO:0051607	defense response to virus	NAS	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IDA	biological_process
GO:0070431	nucleotide-binding oligom erization domain containi ng 2 signaling pathway	IDA	biological_process
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0070555	response to interleukin-1	IGI	biological_process
GO:0071316	cellular response to nico tine	IMP	biological_process
GO:0071347	cellular response to inte rleukin-1	IDA	biological_process
GO:0071354	cellular response to inte rleukin-6	IMP	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IDA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IDA	biological_process
GO:0071375	cellular response to pept ide hormone stimulus	IMP	biological_process
GO:1901223	negative regulation of NI K/NF-kappaB signaling	IMP	biological_process
GO:2000630	positive regulation of mi RNA metabolic process	IMP	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IMP	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05166  HTLV-I infection
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05152  Tuberculosis
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05418  Fluid shear stress and atherosclerosis
hsa05161  Hepatitis B
hsa04062  Chemokine signaling pathway
hsa05164  Influenza A
hsa05145  Toxoplasmosis
hsa05202  Transcriptional misregulation in cancer
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05203  Viral carcinogenesis
hsa04210  Apoptosis
hsa04621  NOD-like receptor signaling pathway
hsa04659  Th17 cell differentiation
hsa04668  TNF signaling pathway
hsa05142  Chagas disease
hsa05215  Prostate cancer
hsa05162  Measles
hsa04657  IL-17 signaling pathway
hsa04380  Osteoclast differentiation
hsa04932  Non-alcoholic fatty liver disease
hsa04024  cAMP signaling pathway
hsa04066  HIF-1 signaling pathway
hsa05160  Hepatitis C
hsa05321  Inflammatory bowel disease
hsa04722  Neurotrophin signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05146  Amoebiasis
hsa04660  T cell receptor signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05140  Leishmaniasis
hsa05220  Chronic myeloid leukemia
hsa05212  Pancreatic cancer
hsa05222  Small cell lung cancer
hsa04917  Prolactin signaling pathway
hsa05133  Pertussis
hsa04064  NF-kappa B signaling pathway
hsa04931  Insulin resistance
hsa04211  Longevity regulating pathway
hsa05134  Legionellosis
hsa05132  Salmonella infection
hsa04071  Sphingolipid signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa05221  Acute myeloid leukemia
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa04662  B cell receptor signaling pathway
hsa04137  Mitophagy - animal
hsa05131  Shigellosis
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa01523  Antifolate resistance
hsa05030  Cocaine addiction

Diseases

Associated diseases	References
Cancer	PMID: 15885892
Endometrial cancer	PMID: 25898371
Endometrial polyp	PMID: 25898371
Endometriosis	PMID: 22196717
Endometriosis	INFBASE22196717
Polycystic ovary syndrome (PCOS)	PMID: 17205306

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22196717	Endometrio sis			48 (24 healthy women, 24 endom etriosis patien ts)		NF-KB1 NF-KB-p65	Show abstract