Endometriosis Knowledgebase

Search Result

Gene id

598

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

BCL2L1 Gene UCSC Ensembl

Aliases

BCL-XL/S, BCL2L, BCLX, Bcl-X, PPP1R52

Gene name

BCL2 like 1

Alternate names

bcl-2-like protein 1, apoptosis regulator Bcl-X, protein phosphatase 1, regulatory subunit 52,

Gene location

20q11.21 (31723998: 31664451) Exons: 6 NC_000020.11

Gene summary(Entrez)

The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform acts as an apoptotic inhibitor and the shorter isoform acts as an apoptotic activator. [provided by RefSeq, Dec 2015]

OMIM

600039

Protein Summary

Protein general information

Q07817

Name: Bcl 2 like protein 1 (Bcl2 L 1) (Apoptosis regulator Bcl X)

Length: 233 Mass: 26,049

Tissue specificity: Bcl-X(S) is expressed at high levels in cells that undergo a high rate of turnover, such as developing lymphocytes. In contrast, Bcl-X(L) is found in tissues containing long-lived postmitotic cells, such as adult brain.

Sequence

MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSL
DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVL
LGSLFSRK

Structural information

Motifs	BH4 (4-24) BH3 (86-100) BH1 (129-148) BH2. (180-195)
Interpro:	IPR013279 IPR002475 IPR004725 IPR020717 IPR020726 IPR020728 IPR003093 IPR020731 IPR026298
Prosite:	PS50062 PS01080 PS01258 PS01259 PS01260 PS50063
Pfam:	PF00452 PF02180
PDB:	1BXL 1G5J 1LXL 1MAZ 1R2D 1R2E 1R2G 1R2H 1R2I 1YSG 1YSI 1YSN 2B48 2LP8 2LPC 2M03 2M04 2ME8 2ME9 2MEJ 2O1Y 2O2M 2O2N 2P1L 2PON 2YJ1 2YQ6 2YQ7 2YXJ 3CVA 3FDL 3FDM 3INQ 3IO8 3PL7 3QKD 3R85 3SP7 3SPF 3WIZ 3ZK6 3ZLN 3ZLO 3ZLR 4A1U 4A1W 4AQ3 4BPK 4C52 4C5D 4CIN
PDBsum:	1BXL 1G5J 1LXL 1MAZ 1R2D 1R2E 1R2G 1R2H 1R2I 1YSG 1YSI 1YSN 2B48 2LP8 2LPC 2M03 2M04 2ME8 2ME9 2MEJ 2O1Y 2O2M 2O2N 2P1L 2PON 2YJ1 2YQ6 2YQ7 2YXJ 3CVA 3FDL 3FDM 3INQ 3IO8 3PL7 3QKD 3R85 3SP7 3SPF 3WIZ 3ZK6 3ZLN 3ZLO 3ZLR 4A1U 4A1W 4AQ3 4BPK 4C52 4C5D 4CIN
DIP:	30916
MINT:	89538
STRING:	ENSP00000302564;

Other Databases

GeneCards: BCL2L1; Malacards: BCL2L1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000910	cytokinesis	IMP	biological_process
GO:0001541	ovarian follicle developm ent	IEA	biological_process
GO:0001701	in utero embryonic develo pment	IEA	biological_process
GO:0001836	release of cytochrome c f rom mitochondria	IDA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	NAS	cellular_component
GO:0005741	mitochondrial outer membr ane	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005743	mitochondrial inner membr ane	IEA	cellular_component
GO:0005759	mitochondrial matrix	IEA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006897	endocytosis	IEA	biological_process
GO:0007093	mitotic cell cycle checkp oint	IMP	biological_process
GO:0007281	germ cell development	IEA	biological_process
GO:0007283	spermatogenesis	IEA	biological_process
GO:0008283	cell proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008584	male gonad development	IEA	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IEA	biological_process
GO:0008637	apoptotic mitochondrial c hanges	TAS	biological_process
GO:0009566	fertilization	IEA	biological_process
GO:0010507	negative regulation of au tophagy	TAS	biological_process
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019050	suppression by virus of h ost apoptotic process	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030054	cell junction	IEA	cellular_component
GO:0030672	synaptic vesicle membrane	IEA	cellular_component
GO:0031965	nuclear membrane	IEA	cellular_component
GO:0034097	response to cytokine	IDA	biological_process
GO:0040007	growth	IEA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IBA	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0046898	response to cycloheximide	IEA	biological_process
GO:0046902	regulation of mitochondri al membrane permeability	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IBA	molecular_function
GO:0051402	neuron apoptotic process	IEA	biological_process
GO:0051434	BH3 domain binding	IPI	molecular_function
GO:0051434	BH3 domain binding	IPI	molecular_function
GO:0051881	regulation of mitochondri al membrane potential	IDA	biological_process
GO:0060154	cellular process regulati ng host cell cycle in res ponse to virus	IEA	biological_process
GO:0070584	mitochondrion morphogenes is	IEA	biological_process
GO:0071230	cellular response to amin o acid stimulus	IEA	biological_process
GO:0071312	cellular response to alka loid	IEA	biological_process
GO:0071480	cellular response to gamm a radiation	IEA	biological_process
GO:0071839	apoptotic process in bone marrow	IEA	biological_process
GO:0090005	negative regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological_process
GO:0090201	negative regulation of re lease of cytochrome c fro m mitochondria	IDA	biological_process
GO:0090201	negative regulation of re lease of cytochrome c fro m mitochondria	IC	biological_process
GO:0097136	Bcl-2 family protein comp lex	IDA	cellular_component
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	IEA	biological_process
GO:0097284	hepatocyte apoptotic proc ess	IEA	biological_process
GO:1900118	negative regulation of ex ecution phase of apoptosi s	IDA	biological_process
GO:1902230	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage	IDA	biological_process
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	TAS	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IDA	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IDA	biological_process
GO:2001244	positive regulation of in trinsic apoptotic signali ng pathway	TAS	biological_process
GO:0000910	cytokinesis	IMP	biological_process
GO:0001541	ovarian follicle developm ent	IEA	biological_process
GO:0001701	in utero embryonic develo pment	IEA	biological_process
GO:0001836	release of cytochrome c f rom mitochondria	IEA	biological_process
GO:0001836	release of cytochrome c f rom mitochondria	IDA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	TAS	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	IEA	cellular_component
GO:0005741	mitochondrial outer membr ane	IEA	cellular_component
GO:0005741	mitochondrial outer membr ane	IEA	cellular_component
GO:0005741	mitochondrial outer membr ane	NAS	cellular_component
GO:0005741	mitochondrial outer membr ane	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005743	mitochondrial inner membr ane	IEA	cellular_component
GO:0005743	mitochondrial inner membr ane	IEA	cellular_component
GO:0005759	mitochondrial matrix	IEA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005815	microtubule organizing ce nter	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0006897	endocytosis	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0007093	mitotic cell cycle checkp oint	IMP	biological_process
GO:0007281	germ cell development	IEA	biological_process
GO:0007283	spermatogenesis	IEA	biological_process
GO:0008283	cell proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008584	male gonad development	IEA	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IEA	biological_process
GO:0008637	apoptotic mitochondrial c hanges	TAS	biological_process
GO:0009314	response to radiation	IEA	biological_process
GO:0009566	fertilization	IEA	biological_process
GO:0009615	response to virus	IEA	biological_process
GO:0010507	negative regulation of au tophagy	TAS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019050	suppression by virus of h ost apoptotic process	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030054	cell junction	IEA	cellular_component
GO:0030672	synaptic vesicle membrane	IEA	cellular_component
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0031965	nuclear membrane	IEA	cellular_component
GO:0031966	mitochondrial membrane	IEA	cellular_component
GO:0034097	response to cytokine	IDA	biological_process
GO:0040007	growth	IEA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IBA	molecular_function
GO:0042981	regulation of apoptotic p rocess	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0045202	synapse	IEA	cellular_component
GO:0046898	response to cycloheximide	IEA	biological_process
GO:0046902	regulation of mitochondri al membrane permeability	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IBA	molecular_function
GO:0051402	neuron apoptotic process	IEA	biological_process
GO:0051434	BH3 domain binding	IPI	molecular_function
GO:0051434	BH3 domain binding	IPI	molecular_function
GO:0051881	regulation of mitochondri al membrane potential	IDA	biological_process
GO:0060154	cellular process regulati ng host cell cycle in res ponse to virus	IEA	biological_process
GO:0070584	mitochondrion morphogenes is	IEA	biological_process
GO:0071230	cellular response to amin o acid stimulus	IEA	biological_process
GO:0071312	cellular response to alka loid	IEA	biological_process
GO:0071480	cellular response to gamm a radiation	IEA	biological_process
GO:0071839	apoptotic process in bone marrow	IEA	biological_process
GO:0090005	negative regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological_process
GO:0090201	negative regulation of re lease of cytochrome c fro m mitochondria	IDA	biological_process
GO:0090201	negative regulation of re lease of cytochrome c fro m mitochondria	IC	biological_process
GO:0097136	Bcl-2 family protein comp lex	IDA	cellular_component
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	IEA	biological_process
GO:0097284	hepatocyte apoptotic proc ess	IEA	biological_process
GO:1900118	negative regulation of ex ecution phase of apoptosi s	IDA	biological_process
GO:1902230	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage	IDA	biological_process
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	TAS	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IDA	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IDA	biological_process
GO:2001244	positive regulation of in trinsic apoptotic signali ng pathway	TAS	biological_process
GO:0000910	cytokinesis	IMP	biological_process
GO:0001836	release of cytochrome c f rom mitochondria	IDA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	TAS	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	NAS	cellular_component
GO:0005741	mitochondrial outer membr ane	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005741	mitochondrial outer membr ane	TAS	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0007093	mitotic cell cycle checkp oint	IMP	biological_process
GO:0008637	apoptotic mitochondrial c hanges	TAS	biological_process
GO:0010507	negative regulation of au tophagy	TAS	biological_process
GO:0019050	suppression by virus of h ost apoptotic process	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0034097	response to cytokine	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IBA	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0046902	regulation of mitochondri al membrane permeability	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IBA	molecular_function
GO:0051434	BH3 domain binding	IPI	molecular_function
GO:0051434	BH3 domain binding	IPI	molecular_function
GO:0051881	regulation of mitochondri al membrane potential	IDA	biological_process
GO:0090005	negative regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological_process
GO:0090201	negative regulation of re lease of cytochrome c fro m mitochondria	IDA	biological_process
GO:0090201	negative regulation of re lease of cytochrome c fro m mitochondria	IC	biological_process
GO:0097136	Bcl-2 family protein comp lex	IDA	cellular_component
GO:1900118	negative regulation of ex ecution phase of apoptosi s	IDA	biological_process
GO:1902230	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage	IDA	biological_process
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	TAS	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IDA	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IDA	biological_process
GO:2001244	positive regulation of in trinsic apoptotic signali ng pathway	TAS	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05166  HTLV-I infection
hsa04014  Ras signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa05145  Toxoplasmosis
hsa05202  Transcriptional misregulation in cancer
hsa04210  Apoptosis
hsa04621  NOD-like receptor signaling pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa05220  Chronic myeloid leukemia
hsa05212  Pancreatic cancer
hsa01524  Platinum drug resistance
hsa05222  Small cell lung cancer
hsa04064  NF-kappa B signaling pathway
hsa04140  Autophagy - animal
hsa04137  Mitophagy - animal
hsa04215  Apoptosis
hsa05014  Amyotrophic lateral sclerosis
PTHR11256:SF12  CCKR signaling map
PTHR11256:SF12  CCKR signaling map
PTHR11256:SF12  CCKR signaling map
PTHR11256:SF12  CCKR signaling map
PTHR11256:SF12  CCKR signaling map
PTHR11256:SF12  CCKR signaling map

Diseases

Associated diseases	References
Endometriosis	PMID: 19467764
Endometriosis	PMID: 19467764
Multiple sclerosis	PMID: 12161031
Endometriosis	INFBASE19467764

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19467764	Endometrio sis			45 (30 healthy controls and 15 patients)		p53 Bcl-x and Bax	Show abstract