Endometriosis Knowledgebase

Search Result

Gene id

604

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

BCL6 Gene UCSC Ensembl

Aliases

BCL5, BCL6A, LAZ3, ZBTB27, ZNF51

Gene name

B-cell CLL/lymphoma 6

Alternate names

B-cell lymphoma 6 protein, B-cell lymphoma 5 protein, B-cell lymphoma 6 protein transcript, BCL-5, BCL-6, cys-his2 zinc finger transcription factor, lymphoma-associated zinc finger gene on chromosome 3, protein LAZ-3, zinc finger and BTB domain-containing protein,

Gene location

3q27.3 (187745724: 187721376) Exons: 12 NC_000003.12

Gene summary(Entrez)

The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Aug 2015]

OMIM

109565

Protein Summary

Protein general information

P41182

Name: B cell lymphoma 6 protein (BCL 6) (B cell lymphoma 5 protein) (BCL 5) (Protein LAZ 3) (Zinc finger and BTB domain containing protein 27) (Zinc finger protein 51)

Length: 706 Mass: 78,846

Tissue specificity: Expressed in germinal center T- and B-cells and in primary immature dendritic cells. {ECO

Sequence

MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLSVINLD
PEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASEAEMVSAIKPPREEFLNSRMLM
PQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFP
KERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKAS
KEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNW
KKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEPENLDLQSPTKLSASGEDSTIPQASRLNNIV
NRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDC
RFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEK
PYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFRHKSQLRL
HLRQKHGAITNTKVQYRVSATDLPPELPKAC

Structural information

Protein Domains	BTB. (32-99)
Interpro:	IPR000210 IPR011333 IPR013087
Prosite:	PS50097 PS00028 PS50157
Pfam:	PF00651
PDB:	1R28 1R29 1R2B 2EN2 2EOS 2LCE 2YRM 3BIM 3E4U 3LBZ 4CP3 4U2M 5H7G 5H7H
PDBsum:	1R28 1R29 1R2B 2EN2 2EOS 2LCE 2YRM 3BIM 3E4U 3LBZ 4CP3 4U2M 5H7G 5H7H
DIP:	2651
MINT:	158757
STRING:	ENSP00000232014;

Other Databases

GeneCards: BCL6; Malacards: BCL6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000060	protein import into nucle us, translocation	IGI	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000902	cell morphogenesis	IEA	biological_process
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IEA	molecular_function
GO:0001161	intronic transcription re gulatory region sequence- specific DNA binding	IEA	molecular_function
GO:0001227	transcriptional repressor activity, RNA polymerase II transcription regulat ory region sequence-speci fic binding	IEA	molecular_function
GO:0001953	negative regulation of ce ll-matrix adhesion	IEA	biological_process
GO:0002467	germinal center formation	IEA	biological_process
GO:0002634	regulation of germinal ce nter formation	NAS	biological_process
GO:0002903	negative regulation of B cell apoptotic process	NAS	biological_process
GO:0003682	chromatin binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0007266	Rho protein signal transd uction	IEA	biological_process
GO:0007283	spermatogenesis	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0030036	actin cytoskeleton organi zation	IEA	biological_process
GO:0030099	myeloid cell differentiat ion	IBA	biological_process
GO:0030183	B cell differentiation	IEA	biological_process
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0030890	positive regulation of B cell proliferation	IEA	biological_process
GO:0031065	positive regulation of hi stone deacetylation	IEA	biological_process
GO:0031490	chromatin DNA binding	IEA	molecular_function
GO:0032764	negative regulation of ma st cell cytokine producti on	IEA	biological_process
GO:0035024	negative regulation of Rh o protein signal transduc tion	IEA	biological_process
GO:0042092	type 2 immune response	IBA	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043087	regulation of GTPase acti vity	IEA	biological_process
GO:0043380	regulation of memory T ce ll differentiation	IEA	biological_process
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0045629	negative regulation of T- helper 2 cell differentia tion	IEA	biological_process
GO:0045666	positive regulation of ne uron differentiation	IEA	biological_process
GO:0045746	negative regulation of No tch signaling pathway	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	NAS	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048294	negative regulation of is otype switching to IgE is otypes	IEA	biological_process
GO:0048821	erythrocyte development	IEA	biological_process
GO:0050727	regulation of inflammator y response	IBA	biological_process
GO:0050767	regulation of neurogenesi s	IBA	biological_process
GO:0050776	regulation of immune resp onse	NAS	biological_process
GO:0051272	positive regulation of ce llular component movement	IEA	biological_process
GO:2000773	negative regulation of ce llular senescence	IEA	biological_process
GO:0005657	replication fork	IDA	cellular_component
GO:0000060	protein import into nucle us, translocation	IGI	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000902	cell morphogenesis	IEA	biological_process
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IEA	molecular_function
GO:0001161	intronic transcription re gulatory region sequence- specific DNA binding	IEA	molecular_function
GO:0001227	transcriptional repressor activity, RNA polymerase II transcription regulat ory region sequence-speci fic binding	IEA	molecular_function
GO:0001953	negative regulation of ce ll-matrix adhesion	IEA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0002467	germinal center formation	IEA	biological_process
GO:0002634	regulation of germinal ce nter formation	NAS	biological_process
GO:0002829	negative regulation of ty pe 2 immune response	IEA	biological_process
GO:0002903	negative regulation of B cell apoptotic process	NAS	biological_process
GO:0003676	nucleic acid binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003682	chromatin binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0007266	Rho protein signal transd uction	IEA	biological_process
GO:0007283	spermatogenesis	IEA	biological_process
GO:0008104	protein localization	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0030036	actin cytoskeleton organi zation	IEA	biological_process
GO:0030099	myeloid cell differentiat ion	IBA	biological_process
GO:0030183	B cell differentiation	IEA	biological_process
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0030890	positive regulation of B cell proliferation	IEA	biological_process
GO:0031065	positive regulation of hi stone deacetylation	IEA	biological_process
GO:0031490	chromatin DNA binding	IEA	molecular_function
GO:0032764	negative regulation of ma st cell cytokine producti on	IEA	biological_process
GO:0035024	negative regulation of Rh o protein signal transduc tion	IEA	biological_process
GO:0042092	type 2 immune response	IEA	biological_process
GO:0042092	type 2 immune response	IBA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043087	regulation of GTPase acti vity	IEA	biological_process
GO:0043380	regulation of memory T ce ll differentiation	IEA	biological_process
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0045596	negative regulation of ce ll differentiation	IEA	biological_process
GO:0045629	negative regulation of T- helper 2 cell differentia tion	IEA	biological_process
GO:0045666	positive regulation of ne uron differentiation	IEA	biological_process
GO:0045746	negative regulation of No tch signaling pathway	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	NAS	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048294	negative regulation of is otype switching to IgE is otypes	IEA	biological_process
GO:0048821	erythrocyte development	IEA	biological_process
GO:0050727	regulation of inflammator y response	IEA	biological_process
GO:0050727	regulation of inflammator y response	IBA	biological_process
GO:0050767	regulation of neurogenesi s	IBA	biological_process
GO:0050776	regulation of immune resp onse	NAS	biological_process
GO:0051272	positive regulation of ce llular component movement	IEA	biological_process
GO:2000773	negative regulation of ce llular senescence	IEA	biological_process
GO:0005657	replication fork	IDA	cellular_component
GO:0000060	protein import into nucle us, translocation	IGI	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0002634	regulation of germinal ce nter formation	NAS	biological_process
GO:0002903	negative regulation of B cell apoptotic process	NAS	biological_process
GO:0003682	chromatin binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0030099	myeloid cell differentiat ion	IBA	biological_process
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0042092	type 2 immune response	IBA	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	NAS	biological_process
GO:0050727	regulation of inflammator y response	IBA	biological_process
GO:0050767	regulation of neurogenesi s	IBA	biological_process
GO:0050776	regulation of immune resp onse	NAS	biological_process
GO:0005657	replication fork	IDA	cellular_component

KEGG pathways

hsa04068 FoxO signaling pathway
hsa05202 Transcriptional misregulation in cancer

Diseases

Associated diseases	References
Atopy	PMID: 9831352
Endometriosis	PMID: 26148093
Follicle center lymphoma	PMID: 11911418
Hairy-cell leukemia	KEGG: H00006
Lymphoma	OMIM: 109565
Primary bone lymphomas	PMID: 14513282
Endometriosis	INFBASE26054109

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26054109	Endometrio sis			98 (46 with end ometriosis, 52 with benign tum ors)		IL-1 TNF IgG IgA Bcl-6 Blimp-1	Show abstract