Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 6277
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol S100A6   Gene   UCSC   Ensembl
Aliases 2A9, 5B10, CABP, CACY, PRA
Gene name S100 calcium binding protein A6
Alternate names protein S100-A6, MLN 4, calcyclin, growth factor-inducible protein 2A9, prolactin receptor-associated protein,
Gene location 1q21.3 (153536240: 153534598)     Exons: 3     NC_000001.11
Gene summary(Entrez) The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma. [provided by RefSeq, Jul 2008]
OMIM 114110

Protein Summary

Protein general information P06703  

Name: Protein S100 A6 (Calcyclin) (Growth factor inducible protein 2A9) (MLN 4) (Prolactin receptor associated protein) (PRA) (S100 calcium binding protein A6)

Length: 90  Mass: 10,180

Sequence MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVT
FLGALALIYNEALKG
Structural information
Protein Domains
EF-hand (12-47)
EF-hand (48-83)
Interpro:  IPR011992 IPR018247 IPR002048 IPR034118 IPR001751 IPR013787
Prosite:   PS00018 PS50222 PS00303

Pfam:  
PF01023
CDD:   cd05029

PDB:  
1K8U 1K96 1K9K 1K9P 2M1K 4YBH
PDBsum:   1K8U 1K96 1K9K 1K9P 2M1K 4YBH
MINT:   3005220
STRING:   ENSP00000357708;
Other Databases GeneCards:  S100A6;  Malacards:  S100A6

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001726 ruffle
IDA cellular_component
GO:0005509 calcium ion binding
IDA molecular_function
GO:0005509 calcium ion binding
NAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005523 tropomyosin binding
IDA molecular_function
GO:0005634 nucleus
IDA cellular_component
GO:0005635 nuclear envelope
NAS cellular_component
GO:0005635 nuclear envelope
IDA cellular_component
GO:0005635 nuclear envelope
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
TAS cellular_component
GO:0005829 cytosol
IDA cellular_component
GO:0007165 signal transduction
TAS biological_process
GO:0007409 axonogenesis
NAS biological_process
GO:0008270 zinc ion binding
IEA molecular_function
GO:0015075 ion transmembrane transpo
rter activity
IEA molecular_function
GO:0031234 extrinsic component of cy
toplasmic side of plasma
membrane
IDA cellular_component
GO:0034220 ion transmembrane transpo
rt
IEA biological_process
GO:0042803 protein homodimerization
activity
IDA molecular_function
GO:0042803 protein homodimerization
activity
IPI molecular_function
GO:0044548 S100 protein binding
IPI molecular_function
GO:0048146 positive regulation of fi
broblast proliferation
NAS biological_process
GO:0048306 calcium-dependent protein
binding
IDA molecular_function
GO:0048471 perinuclear region of cyt
oplasm
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0001726 ruffle
IDA cellular_component
GO:0005509 calcium ion binding
IEA molecular_function
GO:0005509 calcium ion binding
IEA molecular_function
GO:0005509 calcium ion binding
IDA molecular_function
GO:0005509 calcium ion binding
NAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005523 tropomyosin binding
IDA molecular_function
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005635 nuclear envelope
IEA cellular_component
GO:0005635 nuclear envelope
NAS cellular_component
GO:0005635 nuclear envelope
IDA cellular_component
GO:0005635 nuclear envelope
IDA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
TAS cellular_component
GO:0005829 cytosol
IDA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0007165 signal transduction
TAS biological_process
GO:0007409 axonogenesis
NAS biological_process
GO:0008270 zinc ion binding
IEA molecular_function
GO:0015075 ion transmembrane transpo
rter activity
IEA molecular_function
GO:0016020 membrane
IEA cellular_component
GO:0031234 extrinsic component of cy
toplasmic side of plasma
membrane
IDA cellular_component
GO:0034220 ion transmembrane transpo
rt
IEA biological_process
GO:0042803 protein homodimerization
activity
IDA molecular_function
GO:0042803 protein homodimerization
activity
IPI molecular_function
GO:0044548 S100 protein binding
IPI molecular_function
GO:0046872 metal ion binding
IEA molecular_function
GO:0048146 positive regulation of fi
broblast proliferation
NAS biological_process
GO:0048306 calcium-dependent protein
binding
IDA molecular_function
GO:0048471 perinuclear region of cyt
oplasm
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0001726 ruffle
IDA cellular_component
GO:0005509 calcium ion binding
IDA molecular_function
GO:0005509 calcium ion binding
NAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005523 tropomyosin binding
IDA molecular_function
GO:0005634 nucleus
IDA cellular_component
GO:0005635 nuclear envelope
NAS cellular_component
GO:0005635 nuclear envelope
IDA cellular_component
GO:0005635 nuclear envelope
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
TAS cellular_component
GO:0005829 cytosol
IDA cellular_component
GO:0007165 signal transduction
TAS biological_process
GO:0007409 axonogenesis
NAS biological_process
GO:0031234 extrinsic component of cy
toplasmic side of plasma
membrane
IDA cellular_component
GO:0042803 protein homodimerization
activity
IDA molecular_function
GO:0042803 protein homodimerization
activity
IPI molecular_function
GO:0044548 S100 protein binding
IPI molecular_function
GO:0048146 positive regulation of fi
broblast proliferation
NAS biological_process
GO:0048306 calcium-dependent protein
binding
IDA molecular_function
GO:0048471 perinuclear region of cyt
oplasm
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component

Diseases

Associated diseases References
Alzheimer's disease PMID: 19141999
Endometriosis PMID: 28075439
Endometriosis INFBASE28075439

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28075439 Endometrio
sis



Show abstract