Endometriosis Knowledgebase

Search Result

Gene id

6277

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

S100A6 Gene UCSC Ensembl

Aliases

2A9, 5B10, CABP, CACY, PRA

Gene name

S100 calcium binding protein A6

Alternate names

protein S100-A6, MLN 4, calcyclin, growth factor-inducible protein 2A9, prolactin receptor-associated protein,

Gene location

1q21.3 (153536240: 153534598) Exons: 3 NC_000001.11

Gene summary(Entrez)

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma. [provided by RefSeq, Jul 2008]

OMIM

114110

Protein Summary

Protein general information

P06703

Name: Protein S100 A6 (Calcyclin) (Growth factor inducible protein 2A9) (MLN 4) (Prolactin receptor associated protein) (PRA) (S100 calcium binding protein A6)

Length: 90 Mass: 10,180

Sequence

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVT
FLGALALIYNEALKG

Structural information

Protein Domains	EF-hand (12-47) EF-hand (48-83)
Interpro:	IPR011992 IPR018247 IPR002048 IPR034118 IPR001751 IPR013787
Prosite:	PS00018 PS50222 PS00303
Pfam:	PF01023
CDD:	cd05029
PDB:	1K8U 1K96 1K9K 1K9P 2M1K 4YBH
PDBsum:	1K8U 1K96 1K9K 1K9P 2M1K 4YBH
MINT:	3005220
STRING:	ENSP00000357708;

Other Databases

GeneCards: S100A6; Malacards: S100A6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001726	ruffle	IDA	cellular_component
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005509	calcium ion binding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005523	tropomyosin binding	IDA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005635	nuclear envelope	NAS	cellular_component
GO:0005635	nuclear envelope	IDA	cellular_component
GO:0005635	nuclear envelope	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007409	axonogenesis	NAS	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0015075	ion transmembrane transpo rter activity	IEA	molecular_function
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IDA	cellular_component
GO:0034220	ion transmembrane transpo rt	IEA	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0044548	S100 protein binding	IPI	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	NAS	biological_process
GO:0048306	calcium-dependent protein binding	IDA	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0001726	ruffle	IDA	cellular_component
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005509	calcium ion binding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005523	tropomyosin binding	IDA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005635	nuclear envelope	IEA	cellular_component
GO:0005635	nuclear envelope	NAS	cellular_component
GO:0005635	nuclear envelope	IDA	cellular_component
GO:0005635	nuclear envelope	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007409	axonogenesis	NAS	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0015075	ion transmembrane transpo rter activity	IEA	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IDA	cellular_component
GO:0034220	ion transmembrane transpo rt	IEA	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0044548	S100 protein binding	IPI	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	NAS	biological_process
GO:0048306	calcium-dependent protein binding	IDA	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0001726	ruffle	IDA	cellular_component
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005509	calcium ion binding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005523	tropomyosin binding	IDA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005635	nuclear envelope	NAS	cellular_component
GO:0005635	nuclear envelope	IDA	cellular_component
GO:0005635	nuclear envelope	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007409	axonogenesis	NAS	biological_process
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IDA	cellular_component
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0044548	S100 protein binding	IPI	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	NAS	biological_process
GO:0048306	calcium-dependent protein binding	IDA	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Endometriosis	PMID: 28075439
Endometriosis	INFBASE28075439

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
28075439	Endometrio sis						Show abstract