Endometriosis Knowledgebase

Search Result

Gene id

6284

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

S100A13 Gene UCSC Ensembl

Gene name

S100 calcium binding protein A13

Alternate names

protein S100-A13,

Gene location

1q21.3 (153634091: 153618798) Exons: 10 NC_000001.11

Gene summary(Entrez)

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is widely expressed in various types of tissues with a high expression level in thyroid gland. In smooth muscle cells, this protein co-expresses with other family members in the nucleus and in stress fibers, suggesting diverse functions in signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

OMIM

601989

Protein Summary

Protein general information

Q99584

Name: Protein S100 A13 (S100 calcium binding protein A13)

Length: 98 Mass: 11,471

Tissue specificity: Expressed in heart and skeletal muscle.

Sequence

MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNE
YWRLIGELAKEIRKKKDLKIRKK

Structural information

Protein Domains	EF-hand. (18-53)
Interpro:	IPR011992 IPR013787 IPR028487
Pfam:	PF01023
PDB:	1YUR 1YUS 1YUT 1YUU 2EGD 2H2K 2K8M 2KI4 2KI6 2KOT 2L5X 2LE9
PDBsum:	1YUR 1YUS 1YUT 1YUU 2EGD 2H2K 2K8M 2KI4 2KI6 2KOT 2L5X 2LE9
MINT:	4537584
STRING:	ENSP00000344822;

Other Databases

GeneCards: S100A13; Malacards: S100A13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005507	copper ion binding	IDA	molecular_function
GO:0005507	copper ion binding	IDA	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0008270	zinc ion binding	IDA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008289	lipid binding	IEA	molecular_function
GO:0008360	regulation of cell shape	IEA	biological_process
GO:0017134	fibroblast growth factor binding	IPI	molecular_function
GO:0042629	mast cell granule	IEA	cellular_component
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043303	mast cell degranulation	NAS	biological_process
GO:0046688	response to copper ion	IEA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0050663	cytokine secretion	IMP	biological_process
GO:0050703	interleukin-1 alpha secre tion	IDA	biological_process
GO:0050786	RAGE receptor binding	IPI	molecular_function
GO:0051602	response to electrical st imulus	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0005507	copper ion binding	IEA	molecular_function
GO:0005507	copper ion binding	IDA	molecular_function
GO:0005507	copper ion binding	IDA	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0006810	transport	IEA	biological_process
GO:0008270	zinc ion binding	IDA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008289	lipid binding	IEA	molecular_function
GO:0008360	regulation of cell shape	IEA	biological_process
GO:0015031	protein transport	IEA	biological_process
GO:0017134	fibroblast growth factor binding	IPI	molecular_function
GO:0042629	mast cell granule	IEA	cellular_component
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043303	mast cell degranulation	NAS	biological_process
GO:0046688	response to copper ion	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0050663	cytokine secretion	IMP	biological_process
GO:0050703	interleukin-1 alpha secre tion	IDA	biological_process
GO:0050786	RAGE receptor binding	IPI	molecular_function
GO:0051602	response to electrical st imulus	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0005507	copper ion binding	IDA	molecular_function
GO:0005507	copper ion binding	IDA	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0008270	zinc ion binding	IDA	molecular_function
GO:0017134	fibroblast growth factor binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043303	mast cell degranulation	NAS	biological_process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0050663	cytokine secretion	IMP	biological_process
GO:0050703	interleukin-1 alpha secre tion	IDA	biological_process
GO:0050786	RAGE receptor binding	IPI	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component

Diseases

Associated diseases	References
Endometriosis	PMID: 15821778
Endometriosis	INFBASE15821778

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
15821778	Endometrio sis					Endoglin S100A13	Show abstract