Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 6286
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol S100P   Gene   UCSC   Ensembl
Aliases MIG9
Gene name S100 calcium binding protein P
Alternate names protein S100-P, migration-inducing gene 9 protein, protein S100-E,
Gene location 4p16.1 (6693838: 6697169)     Exons: 2     NC_000004.12
Gene summary(Entrez) The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer. [provided by RefSeq, Jul 2008]
OMIM 600614

Protein Summary

Protein general information P25815  

Name: Protein S100 P (Migration inducing gene 9 protein) (MIG9) (Protein S100 E) (S100 calcium binding protein P)

Length: 95  Mass: 10,400

Tissue specificity: Detected in all of the tissues except brain, testis and small intestine, expression level is higher in placenta, heart, lung, skeletal muscle, spleen and leukocyte. Up-regulated in various pancreatic ductal adenocarcinomas and pancreat

Sequence MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFI
VFVAAITSACHKYFEKAGLK
Structural information
Protein Domains
EF-hand (12-47)
EF-hand (49-84)
Interpro:  IPR011992 IPR002048 IPR034325 IPR001751 IPR013787 IPR028494
Prosite:   PS50222 PS00303

Pfam:  
PF01023
CDD:   cd00213

PDB:  
1J55 1OZO 2MJW
PDBsum:   1J55 1OZO 2MJW
MINT:   239013
STRING:   ENSP00000296370;
Other Databases GeneCards:  S100P;  Malacards:  S100P

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000287 magnesium ion binding
TAS molecular_function
GO:0005509 calcium ion binding
IEA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IDA cellular_component
GO:0005737 cytoplasm
TAS cellular_component
GO:0010033 response to organic subst
ance
IEP biological_process
GO:0031528 microvillus membrane
IEA cellular_component
GO:0043542 endothelial cell migratio
n
IMP biological_process
GO:0048306 calcium-dependent protein
binding
IPI molecular_function
GO:0050786 RAGE receptor binding
IEA molecular_function
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0000287 magnesium ion binding
TAS molecular_function
GO:0005509 calcium ion binding
IEA molecular_function
GO:0005509 calcium ion binding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
TAS cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0010033 response to organic subst
ance
IEP biological_process
GO:0016020 membrane
IEA cellular_component
GO:0031528 microvillus membrane
IEA cellular_component
GO:0042995 cell projection
IEA cellular_component
GO:0043542 endothelial cell migratio
n
IMP biological_process
GO:0046872 metal ion binding
IEA molecular_function
GO:0048306 calcium-dependent protein
binding
IPI molecular_function
GO:0050786 RAGE receptor binding
IEA molecular_function
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0000287 magnesium ion binding
TAS molecular_function
GO:0005509 calcium ion binding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IDA cellular_component
GO:0005737 cytoplasm
TAS cellular_component
GO:0010033 response to organic subst
ance
IEP biological_process
GO:0043542 endothelial cell migratio
n
IMP biological_process
GO:0048306 calcium-dependent protein
binding
IPI molecular_function
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component

Diseases

Associated diseases References
Endometrial cancer PMID: 24966918
Endometriosis PMID: 26148093
Endometriosis INFBASE22147918
Endometriosis INFBASE17081533

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
22147918 Endometrio
sis

73 (35 fertile
women without e
ndometriosis, 3
8 women with su
rgically diagno
sed endometrios
is)
S100P
S100A4
osteopontin (OPN) or anterior gradient homologue 2 (AGR2)
Show abstract
17081533 Endometrio
sis

73 (35 fertile
women without e
ndometriosis, 3
8 women with su
rgically diagno
sed endometrios
is)
S100P
AGR2 and OPN
Show abstract