Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 6288
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol SAA1   Gene   UCSC   Ensembl
Aliases PIG4, SAA, SAA2, TP53I4
Gene name serum amyloid A1
Alternate names serum amyloid A-1 protein, serum amyloid A protein, tumor protein p53 inducible protein 4,
Gene location 11p15.1 (18266224: 18269976)     Exons: 4     NC_000011.10
Gene summary(Entrez) This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11. [provided by RefSeq, Feb 2016]
OMIM 104750

Protein Summary

Protein general information P0DJI8  

Name: Serum amyloid A 1 protein (SAA) [Cleaved into: Amyloid protein A (Amyloid fibril protein AA); Serum amyloid protein A(2 104); Serum amyloid protein A(3 104); Serum amyloid protein A(2 103); Serum amyloid protein A(2 102); Serum amyloid protein A(4 101)]

Length: 122  Mass: 13,532

Tissue specificity: Expressed by the liver; secreted in plasma (at protein level). {ECO

Sequence MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEA
ISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Structural information
Interpro:  IPR000096
Prosite:   PS00992

Pfam:  
PF00277

PDB:  
4IP8 4IP9
PDBsum:   4IP8 4IP9
STRING:   ENSP00000348918;
Other Databases GeneCards:  SAA1;  Malacards:  SAA1

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000187 activation of MAPK activi
ty
IDA biological_process
GO:0001664 G-protein coupled recepto
r binding
IDA molecular_function
GO:0005576 extracellular region
NAS cellular_component
GO:0005576 extracellular region
NAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005881 cytoplasmic microtubule
IDA cellular_component
GO:0006898 receptor-mediated endocyt
osis
TAS biological_process
GO:0006953 acute-phase response
NAS biological_process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
NAS biological_process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
IDA biological_process
GO:0008201 heparin binding
IEA molecular_function
GO:0030168 platelet activation
NAS biological_process
GO:0030593 neutrophil chemotaxis
NAS biological_process
GO:0034364 high-density lipoprotein
particle
IEA cellular_component
GO:0042056 chemoattractant activity
IBA molecular_function
GO:0044267 cellular protein metaboli
c process
TAS biological_process
GO:0045087 innate immune response
TAS biological_process
GO:0045785 positive regulation of ce
ll adhesion
IDA biological_process
GO:0045785 positive regulation of ce
ll adhesion
NAS biological_process
GO:0045785 positive regulation of ce
ll adhesion
IDA biological_process
GO:0048246 macrophage chemotaxis
IDA biological_process
GO:0048247 lymphocyte chemotaxis
IDA biological_process
GO:0050708 regulation of protein sec
retion
NAS biological_process
GO:0050715 positive regulation of cy
tokine secretion
IDA biological_process
GO:0050716 positive regulation of in
terleukin-1 secretion
NAS biological_process
GO:0050728 negative regulation of in
flammatory response
NAS biological_process
GO:0050918 positive chemotaxis
IEA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0071682 endocytic vesicle lumen
TAS cellular_component
GO:0000187 activation of MAPK activi
ty
IDA biological_process
GO:0001664 G-protein coupled recepto
r binding
IDA molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
NAS cellular_component
GO:0005576 extracellular region
NAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005881 cytoplasmic microtubule
IDA cellular_component
GO:0006898 receptor-mediated endocyt
osis
TAS biological_process
GO:0006953 acute-phase response
IEA biological_process
GO:0006953 acute-phase response
IEA biological_process
GO:0006953 acute-phase response
NAS biological_process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
NAS biological_process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
IDA biological_process
GO:0008201 heparin binding
IEA molecular_function
GO:0030168 platelet activation
NAS biological_process
GO:0030593 neutrophil chemotaxis
NAS biological_process
GO:0034364 high-density lipoprotein
particle
IEA cellular_component
GO:0042056 chemoattractant activity
IBA molecular_function
GO:0044267 cellular protein metaboli
c process
TAS biological_process
GO:0045087 innate immune response
TAS biological_process
GO:0045785 positive regulation of ce
ll adhesion
IDA biological_process
GO:0045785 positive regulation of ce
ll adhesion
NAS biological_process
GO:0045785 positive regulation of ce
ll adhesion
IDA biological_process
GO:0048246 macrophage chemotaxis
IDA biological_process
GO:0048247 lymphocyte chemotaxis
IDA biological_process
GO:0050708 regulation of protein sec
retion
NAS biological_process
GO:0050715 positive regulation of cy
tokine secretion
IDA biological_process
GO:0050716 positive regulation of in
terleukin-1 secretion
NAS biological_process
GO:0050728 negative regulation of in
flammatory response
NAS biological_process
GO:0050918 positive chemotaxis
IEA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0071682 endocytic vesicle lumen
TAS cellular_component
GO:0000187 activation of MAPK activi
ty
IDA biological_process
GO:0001664 G-protein coupled recepto
r binding
IDA molecular_function
GO:0005576 extracellular region
NAS cellular_component
GO:0005576 extracellular region
NAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005881 cytoplasmic microtubule
IDA cellular_component
GO:0006898 receptor-mediated endocyt
osis
TAS biological_process
GO:0006953 acute-phase response
NAS biological_process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
NAS biological_process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
IDA biological_process
GO:0030168 platelet activation
NAS biological_process
GO:0030593 neutrophil chemotaxis
NAS biological_process
GO:0042056 chemoattractant activity
IBA molecular_function
GO:0044267 cellular protein metaboli
c process
TAS biological_process
GO:0045087 innate immune response
TAS biological_process
GO:0045785 positive regulation of ce
ll adhesion
IDA biological_process
GO:0045785 positive regulation of ce
ll adhesion
NAS biological_process
GO:0045785 positive regulation of ce
ll adhesion
IDA biological_process
GO:0048246 macrophage chemotaxis
IDA biological_process
GO:0048247 lymphocyte chemotaxis
IDA biological_process
GO:0050708 regulation of protein sec
retion
NAS biological_process
GO:0050715 positive regulation of cy
tokine secretion
IDA biological_process
GO:0050716 positive regulation of in
terleukin-1 secretion
NAS biological_process
GO:0050728 negative regulation of in
flammatory response
NAS biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0071682 endocytic vesicle lumen
TAS cellular_component

Diseases

Associated diseases References
Amyloidosis PMID: 14696796
Endometriosis PMID: 19230253
Hypertension PMID: 11592044
Male infertility PMID: 9111881
Pelvic endometriosis INFBASE24050030
Endometriosis INFBASE19230253
Pelvic endometriosis INFBASE9436699
Pelvic endometriosis PMID: 9436699
Primary ovarian insufficiency (POI) PMID: 25647778
Rheumatoid arthritis PMID: 17968686

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
24050030 Endometrio
sis (Pelvi
c)

76 (57 with end
ometriosis, 13
without endomet
riosis)

Show abstract
19230253 Endometrio
sis

50 (15 women wi
thout endometri
osis, as confir
med by laparosc
opy (group A),
35 patients wit
h pelvic endome
triosis)
Ca 125 II
C-reactive protein (CRP)
serum amyloid A (SAA)
anticardiolipin antibody (aCL)
Show abstract
9436699 Endometrio
sis (pelvi
c)

50 (15 women wi
thout endometri
osis, as confir
med by laparosc
opy (group A),
35 patients wit
h pelvic endome
triosis diagnos
ed by laparosco
py or laparotom
y (group B))
CRP
CA 125 II
SAA
Acl
Show abstract