Endometriosis Knowledgebase

Search Result

Gene id

6320

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CLEC11A Gene UCSC Ensembl

Aliases

CLECSF3, LSLCL, P47, SCGF

Gene name

C-type lectin domain containing 11A

Alternate names

C-type lectin domain family 11 member A, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 3, C-type lectin superfamily member 3, lymphocyte secreted C-type lectin, lymphocyte secreted long form of C-type lectin, osteolecti,

Gene location

19q13.33 (132073791: 132076169) Exons: 4 NC_000005.10

Gene summary(Entrez)

This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined. [provided by RefSeq, Jul 2008]

OMIM

604713

Protein Summary

Protein general information

Q9Y240

Name: C-type lectin domain family 11 member A (C-type lectin superfamily member 3) (Lymphocyte secreted C-type lectin) (Osteolectin) (Stem cell growth factor) (p47)

Length: 323 Mass: 35,695

Tissue specificity: Expressed in skeletal tissues including bone marrow, chondrocytes, primary ossification center-associated cells, the perichondrium and periosteum. Lower levels of expression were detected in spleen, thymus, appendix and fetal liver. {E

Sequence

MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKED
WEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAA
GDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTR
YLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQA
SDDGSWWDHDCQRRLYYVCEFPF

Structural information

Protein Domains	C-type (183-320)
Motifs	Cell attachment(61-63)
Interpro:	IPR001304 IPR016186 IPR018378 IPR016187
Prosite:	PS00615 PS50041
Pfam:	PF00059
STRING:	ENSP00000250340;

Other Databases

GeneCards: CLEC11A; Malacards: CLEC11A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0030246	carbohydrate binding	NAS	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0030246	carbohydrate binding	IEA	molecular_function
GO:0030246	carbohydrate binding	NAS	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0030246	carbohydrate binding	NAS	molecular_function

Diseases

Associated diseases	References
Endometriosis	PMID: 28433374
Endometriosis	INFBASE28433374
Vitiligo	PMID: 21085187
Endometriosis	PMID: 28433374

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
28433374	Endometrio sis			107 female infe rtility (56 end ometriosis pati ents, 38 patien ts without endo metriosis)	Female infertility		Show abstract