Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 633
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol BGN   Gene   UCSC   Ensembl
Aliases DSPG1, MRLS, PG-S1, PGI, SEMDX, SLRR1A
Gene name biglycan
Alternate names biglycan, bone/cartilage proteoglycan-I, dermatan sulphate proteoglycan I, small leucine-rich protein 1A,
Gene location Xq28 (153494888: 153509553)     Exons: 8     NC_000023.11
Gene summary(Entrez) This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in bone growth, muscle development and regeneration, and collagen fibril assembly in multiple tissues. This protein may also regulate inflammation and innate immunity. Additionally, the encoded protein may contribute to atherosclerosis and aortic valve stenosis in human patients. This gene and the related gene decorin are thought to be the result of a gene duplication. [provided by RefSeq, Nov 2015]
OMIM 301870

Protein Summary

Protein general information P21810  

Name: Biglycan (Bone/cartilage proteoglycan I) (PG S1)

Length: 368  Mass: 41,654

Tissue specificity: Found in several connective tissues, especially in articular cartilages.

Sequence MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQ
CSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHL
VEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPK
DLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLK
LLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
Structural information
Interpro:  IPR028547 IPR032675 IPR001611 IPR003591 IPR000372 IPR016352
Prosite:   PS51450

Pfam:  
PF13855 PF01462
MINT:   4529946
STRING:   ENSP00000327336;
Other Databases GeneCards:  BGN;  Malacards:  BGN

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001974 blood vessel remodeling
IEA biological_process
GO:0004860 protein kinase inhibitor
activity
IBA molecular_function
GO:0005201 extracellular matrix stru
ctural constituent
NAS molecular_function
GO:0005539 glycosaminoglycan binding
IEA molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005578 proteinaceous extracellul
ar matrix
NAS cellular_component
GO:0005737 cytoplasm
IBA cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0006469 negative regulation of pr
otein kinase activity
IBA biological_process
GO:0008150 biological_process
ND biological_process
GO:0009986 cell surface
IDA cellular_component
GO:0019221 cytokine-mediated signali
ng pathway
IBA biological_process
GO:0019800 peptide cross-linking via
chondroitin 4-sulfate gl
ycosaminoglycan
IEA biological_process
GO:0030133 transport vesicle
IDA cellular_component
GO:0030198 extracellular matrix orga
nization
TAS biological_process
GO:0030203 glycosaminoglycan metabol
ic process
TAS biological_process
GO:0030206 chondroitin sulfate biosy
nthetic process
TAS biological_process
GO:0030207 chondroitin sulfate catab
olic process
TAS biological_process
GO:0030208 dermatan sulfate biosynth
etic process
TAS biological_process
GO:0042383 sarcolemma
IEA cellular_component
GO:0043202 lysosomal lumen
TAS cellular_component
GO:0043202 lysosomal lumen
TAS cellular_component
GO:0043202 lysosomal lumen
TAS cellular_component
GO:0046426 negative regulation of JA
K-STAT cascade
IBA biological_process
GO:0050840 extracellular matrix bind
ing
IEA molecular_function
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0031012 extracellular matrix
IDA cellular_component
GO:0031012 extracellular matrix
ISS cellular_component
GO:0001974 blood vessel remodeling
IEA biological_process
GO:0004860 protein kinase inhibitor
activity
IBA molecular_function
GO:0005201 extracellular matrix stru
ctural constituent
NAS molecular_function
GO:0005539 glycosaminoglycan binding
IEA molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005578 proteinaceous extracellul
ar matrix
IEA cellular_component
GO:0005578 proteinaceous extracellul
ar matrix
IEA cellular_component
GO:0005578 proteinaceous extracellul
ar matrix
IEA cellular_component
GO:0005578 proteinaceous extracellul
ar matrix
NAS cellular_component
GO:0005622 intracellular
IEA cellular_component
GO:0005737 cytoplasm
IBA cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0006469 negative regulation of pr
otein kinase activity
IBA biological_process
GO:0008150 biological_process
ND biological_process
GO:0009986 cell surface
IDA cellular_component
GO:0019221 cytokine-mediated signali
ng pathway
IBA biological_process
GO:0019800 peptide cross-linking via
chondroitin 4-sulfate gl
ycosaminoglycan
IEA biological_process
GO:0030133 transport vesicle
IDA cellular_component
GO:0030198 extracellular matrix orga
nization
TAS biological_process
GO:0030203 glycosaminoglycan metabol
ic process
TAS biological_process
GO:0030206 chondroitin sulfate biosy
nthetic process
TAS biological_process
GO:0030207 chondroitin sulfate catab
olic process
TAS biological_process
GO:0030208 dermatan sulfate biosynth
etic process
TAS biological_process
GO:0042383 sarcolemma
IEA cellular_component
GO:0043202 lysosomal lumen
TAS cellular_component
GO:0043202 lysosomal lumen
TAS cellular_component
GO:0043202 lysosomal lumen
TAS cellular_component
GO:0046426 negative regulation of JA
K-STAT cascade
IBA biological_process
GO:0050840 extracellular matrix bind
ing
IEA molecular_function
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0031012 extracellular matrix
IDA cellular_component
GO:0031012 extracellular matrix
ISS cellular_component
GO:0004860 protein kinase inhibitor
activity
IBA molecular_function
GO:0005201 extracellular matrix stru
ctural constituent
NAS molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005578 proteinaceous extracellul
ar matrix
NAS cellular_component
GO:0005737 cytoplasm
IBA cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0005796 Golgi lumen
TAS cellular_component
GO:0006469 negative regulation of pr
otein kinase activity
IBA biological_process
GO:0008150 biological_process
ND biological_process
GO:0009986 cell surface
IDA cellular_component
GO:0019221 cytokine-mediated signali
ng pathway
IBA biological_process
GO:0030133 transport vesicle
IDA cellular_component
GO:0030198 extracellular matrix orga
nization
TAS biological_process
GO:0030203 glycosaminoglycan metabol
ic process
TAS biological_process
GO:0030206 chondroitin sulfate biosy
nthetic process
TAS biological_process
GO:0030207 chondroitin sulfate catab
olic process
TAS biological_process
GO:0030208 dermatan sulfate biosynth
etic process
TAS biological_process
GO:0043202 lysosomal lumen
TAS cellular_component
GO:0043202 lysosomal lumen
TAS cellular_component
GO:0043202 lysosomal lumen
TAS cellular_component
GO:0046426 negative regulation of JA
K-STAT cascade
IBA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0031012 extracellular matrix
IDA cellular_component
GO:0031012 extracellular matrix
ISS cellular_component

Diseases

Associated diseases References
Endometrial cancer PMID: 26275380
Endometriosis PMID: 21397694
Meester-Loeys syndrome OMIM: 301870
Spondyloepimetaphyseal dysplasia OMIM: 301870
Endometriosis INFBASE21397694

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21397694 Endometrio
sis

20 (11 ovarian
endometriosis s
amples, 9 contr
ol endometrium
samples)
BGN
Show abstract