Endometriosis Knowledgebase

Search Result

Gene id

633

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

BGN Gene UCSC Ensembl

Aliases

DSPG1, MRLS, PG-S1, PGI, SEMDX, SLRR1A

Gene name

biglycan

Alternate names

biglycan, bone/cartilage proteoglycan-I, dermatan sulphate proteoglycan I, small leucine-rich protein 1A,

Gene location

Xq28 (153494888: 153509553) Exons: 8 NC_000023.11

Gene summary(Entrez)

This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in bone growth, muscle development and regeneration, and collagen fibril assembly in multiple tissues. This protein may also regulate inflammation and innate immunity. Additionally, the encoded protein may contribute to atherosclerosis and aortic valve stenosis in human patients. This gene and the related gene decorin are thought to be the result of a gene duplication. [provided by RefSeq, Nov 2015]

OMIM

301870

Protein Summary

Protein general information

P21810

Name: Biglycan (Bone/cartilage proteoglycan I) (PG S1)

Length: 368 Mass: 41,654

Tissue specificity: Found in several connective tissues, especially in articular cartilages.

Sequence

MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQ
CSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHL
VEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPK
DLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLK
LLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

Structural information

Interpro:	IPR028547 IPR032675 IPR001611 IPR003591 IPR000372 IPR016352
Prosite:	PS51450
Pfam:	PF13855 PF01462
MINT:	4529946
STRING:	ENSP00000327336;

Other Databases

GeneCards: BGN; Malacards: BGN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001974	blood vessel remodeling	IEA	biological_process
GO:0004860	protein kinase inhibitor activity	IBA	molecular_function
GO:0005201	extracellular matrix stru ctural constituent	NAS	molecular_function
GO:0005539	glycosaminoglycan binding	IEA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	NAS	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IBA	biological_process
GO:0008150	biological_process	ND	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0019800	peptide cross-linking via chondroitin 4-sulfate gl ycosaminoglycan	IEA	biological_process
GO:0030133	transport vesicle	IDA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030203	glycosaminoglycan metabol ic process	TAS	biological_process
GO:0030206	chondroitin sulfate biosy nthetic process	TAS	biological_process
GO:0030207	chondroitin sulfate catab olic process	TAS	biological_process
GO:0030208	dermatan sulfate biosynth etic process	TAS	biological_process
GO:0042383	sarcolemma	IEA	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0046426	negative regulation of JA K-STAT cascade	IBA	biological_process
GO:0050840	extracellular matrix bind ing	IEA	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	ISS	cellular_component
GO:0001974	blood vessel remodeling	IEA	biological_process
GO:0004860	protein kinase inhibitor activity	IBA	molecular_function
GO:0005201	extracellular matrix stru ctural constituent	NAS	molecular_function
GO:0005539	glycosaminoglycan binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	NAS	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IBA	biological_process
GO:0008150	biological_process	ND	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0019800	peptide cross-linking via chondroitin 4-sulfate gl ycosaminoglycan	IEA	biological_process
GO:0030133	transport vesicle	IDA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030203	glycosaminoglycan metabol ic process	TAS	biological_process
GO:0030206	chondroitin sulfate biosy nthetic process	TAS	biological_process
GO:0030207	chondroitin sulfate catab olic process	TAS	biological_process
GO:0030208	dermatan sulfate biosynth etic process	TAS	biological_process
GO:0042383	sarcolemma	IEA	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0046426	negative regulation of JA K-STAT cascade	IBA	biological_process
GO:0050840	extracellular matrix bind ing	IEA	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	ISS	cellular_component
GO:0004860	protein kinase inhibitor activity	IBA	molecular_function
GO:0005201	extracellular matrix stru ctural constituent	NAS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	NAS	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IBA	biological_process
GO:0008150	biological_process	ND	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0030133	transport vesicle	IDA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030203	glycosaminoglycan metabol ic process	TAS	biological_process
GO:0030206	chondroitin sulfate biosy nthetic process	TAS	biological_process
GO:0030207	chondroitin sulfate catab olic process	TAS	biological_process
GO:0030208	dermatan sulfate biosynth etic process	TAS	biological_process
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0046426	negative regulation of JA K-STAT cascade	IBA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	ISS	cellular_component

Diseases

Associated diseases	References
Endometrial cancer	PMID: 26275380
Endometriosis	PMID: 21397694
Meester-Loeys syndrome	OMIM: 301870
Spondyloepimetaphyseal dysplasia	OMIM: 301870
Endometriosis	INFBASE21397694

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21397694	Endometrio sis			20 (11 ovarian endometriosis s amples, 9 contr ol endometrium samples)		BGN	Show abstract