Endometriosis Knowledgebase

Search Result

Gene id

6348

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CCL3 Gene UCSC Ensembl

Aliases

G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3

Gene name

C-C motif chemokine ligand 3

Alternate names

C-C motif chemokine 3, G0/G1 switch regulatory protein 19-1, PAT 464.1, SIS-beta, chemokine (C-C motif) ligand 3, macrophage inflammatory protein 1-alpha, small inducible cytokine A3 (homologous to mouse Mip-1a), tonsillar lymphocyte LD78 alpha protein,

Gene location

17q12 (36090159: 36088255) Exons: 3 NC_000017.11

Gene summary(Entrez)

This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.[provided by RefSeq, Sep 2010]

OMIM

182283

Protein Summary

Protein general information

P10147

Name: C C motif chemokine 3 (G0/G1 switch regulatory protein 19 1) (Macrophage inflammatory protein 1 alpha) (MIP 1 alpha) (PAT 464.1) (SIS beta) (Small inducible cytokine A3) (Tonsillar lymphocyte LD78 alpha protein) [Cleaved into: MIP 1 alpha(4 69) (LD78 alph

Length: 92 Mass: 10,085

Sequence

MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCAD
PSEEWVQKYVSDLELSA

Structural information

Interpro:	IPR000827 IPR001811
Prosite:	PS00472
Pfam:	PF00048
PDB:	1B50 1B53 2X69 2X6G 3FPU 3H44 3KBX 4RA8 4ZKB 5COR 5D65
PDBsum:	1B50 1B53 2X69 2X6G 3FPU 3H44 3KBX 4RA8 4ZKB 5COR 5D65
DIP:	5837
MINT:	103148
STRING:	ENSP00000225245;

Other Databases

GeneCards: CCL3; Malacards: CCL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	IEP	biological_process
GO:0000165	MAPK cascade	IMP	biological_process
GO:0001649	osteoblast differentiatio n	IEP	biological_process
GO:0001775	cell activation	IDA	biological_process
GO:0002548	monocyte chemotaxis	IC	biological_process
GO:0002548	monocyte chemotaxis	IDA	biological_process
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004698	calcium-dependent protein kinase C activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005622	intracellular	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0006816	calcium ion transport	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IDA	biological_process
GO:0006887	exocytosis	IDA	biological_process
GO:0006935	chemotaxis	IDA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0007010	cytoskeleton organization	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	IDA	biological_process
GO:0007610	behavior	IDA	biological_process
GO:0008009	chemokine activity	IDA	molecular_function
GO:0008009	chemokine activity	IDA	molecular_function
GO:0008360	regulation of cell shape	IDA	biological_process
GO:0009636	response to toxic substan ce	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010818	T cell chemotaxis	IDA	biological_process
GO:0014808	release of sequestered ca lcium ion into cytosol by sarcoplasmic reticulum	IDA	biological_process
GO:0016004	phospholipase activator a ctivity	IDA	molecular_function
GO:0016301	kinase activity	IDA	molecular_function
GO:0019722	calcium-mediated signalin g	IDA	biological_process
GO:0019722	calcium-mediated signalin g	IDA	biological_process
GO:0023052	signaling	IEP	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030502	negative regulation of bo ne mineralization	IDA	biological_process
GO:0030593	neutrophil chemotaxis	IDA	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IDA	biological_process
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031730	CCR5 chemokine receptor b inding	IPI	molecular_function
GO:0031730	CCR5 chemokine receptor b inding	IPI	molecular_function
GO:0032760	positive regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043308	eosinophil degranulation	IDA	biological_process
GO:0043491	protein kinase B signalin g	IMP	biological_process
GO:0043525	positive regulation of ne uron apoptotic process	ISS	biological_process
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0043615	astrocyte cell migration	ISS	biological_process
GO:0043922	negative regulation by ho st of viral transcription	IDA	biological_process
GO:0045671	negative regulation of os teoclast differentiation	IDA	biological_process
GO:0048245	eosinophil chemotaxis	IDA	biological_process
GO:0048246	macrophage chemotaxis	ISS	biological_process
GO:0048247	lymphocyte chemotaxis	IDA	biological_process
GO:0050718	positive regulation of in terleukin-1 beta secretio n	ISS	biological_process
GO:0050729	positive regulation of in flammatory response	ISS	biological_process
GO:0050729	positive regulation of in flammatory response	IBA	biological_process
GO:0050850	positive regulation of ca lcium-mediated signaling	IMP	biological_process
GO:0050918	positive chemotaxis	IEA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IEP	biological_process
GO:0051928	positive regulation of ca lcium ion transport	IDA	biological_process
GO:0051928	positive regulation of ca lcium ion transport	IDA	biological_process
GO:0051930	regulation of sensory per ception of pain	IDA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070723	response to cholesterol	IDA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IEP	biological_process
GO:0071347	cellular response to inte rleukin-1	IEP	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IEP	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IDA	biological_process
GO:0071621	granulocyte chemotaxis	IDA	biological_process
GO:0090280	positive regulation of ca lcium ion import	TAS	biological_process
GO:2000503	positive regulation of na tural killer cell chemota xis	IDA	biological_process
GO:0000165	MAPK cascade	IEP	biological_process
GO:0000165	MAPK cascade	IMP	biological_process
GO:0001649	osteoblast differentiatio n	IEP	biological_process
GO:0001775	cell activation	IDA	biological_process
GO:0002548	monocyte chemotaxis	IC	biological_process
GO:0002548	monocyte chemotaxis	IDA	biological_process
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004698	calcium-dependent protein kinase C activity	IDA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005622	intracellular	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0006816	calcium ion transport	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IDA	biological_process
GO:0006887	exocytosis	IDA	biological_process
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	IDA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0007010	cytoskeleton organization	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	IDA	biological_process
GO:0007610	behavior	IDA	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008009	chemokine activity	IDA	molecular_function
GO:0008009	chemokine activity	IDA	molecular_function
GO:0008360	regulation of cell shape	IDA	biological_process
GO:0009636	response to toxic substan ce	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010818	T cell chemotaxis	IDA	biological_process
GO:0014808	release of sequestered ca lcium ion into cytosol by sarcoplasmic reticulum	IDA	biological_process
GO:0016004	phospholipase activator a ctivity	IDA	molecular_function
GO:0016301	kinase activity	IDA	molecular_function
GO:0019722	calcium-mediated signalin g	IDA	biological_process
GO:0019722	calcium-mediated signalin g	IDA	biological_process
GO:0023052	signaling	IEP	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030502	negative regulation of bo ne mineralization	IDA	biological_process
GO:0030593	neutrophil chemotaxis	IDA	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IDA	biological_process
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031730	CCR5 chemokine receptor b inding	IPI	molecular_function
GO:0031730	CCR5 chemokine receptor b inding	IPI	molecular_function
GO:0032760	positive regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043308	eosinophil degranulation	IDA	biological_process
GO:0043491	protein kinase B signalin g	IMP	biological_process
GO:0043525	positive regulation of ne uron apoptotic process	ISS	biological_process
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0043615	astrocyte cell migration	ISS	biological_process
GO:0043922	negative regulation by ho st of viral transcription	IDA	biological_process
GO:0045671	negative regulation of os teoclast differentiation	IDA	biological_process
GO:0048245	eosinophil chemotaxis	IDA	biological_process
GO:0048246	macrophage chemotaxis	ISS	biological_process
GO:0048247	lymphocyte chemotaxis	IDA	biological_process
GO:0050718	positive regulation of in terleukin-1 beta secretio n	ISS	biological_process
GO:0050729	positive regulation of in flammatory response	ISS	biological_process
GO:0050729	positive regulation of in flammatory response	IBA	biological_process
GO:0050850	positive regulation of ca lcium-mediated signaling	IMP	biological_process
GO:0050918	positive chemotaxis	IEA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IEP	biological_process
GO:0051928	positive regulation of ca lcium ion transport	IDA	biological_process
GO:0051928	positive regulation of ca lcium ion transport	IDA	biological_process
GO:0051930	regulation of sensory per ception of pain	IDA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070723	response to cholesterol	IDA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IEP	biological_process
GO:0071347	cellular response to inte rleukin-1	IEP	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IEP	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IDA	biological_process
GO:0071621	granulocyte chemotaxis	IDA	biological_process
GO:0090280	positive regulation of ca lcium ion import	TAS	biological_process
GO:2000503	positive regulation of na tural killer cell chemota xis	IDA	biological_process
GO:0000165	MAPK cascade	IEP	biological_process
GO:0000165	MAPK cascade	IMP	biological_process
GO:0001649	osteoblast differentiatio n	IEP	biological_process
GO:0001775	cell activation	IDA	biological_process
GO:0002548	monocyte chemotaxis	IC	biological_process
GO:0002548	monocyte chemotaxis	IDA	biological_process
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004698	calcium-dependent protein kinase C activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005622	intracellular	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0006816	calcium ion transport	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IDA	biological_process
GO:0006887	exocytosis	IDA	biological_process
GO:0006935	chemotaxis	IDA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0007010	cytoskeleton organization	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	IDA	biological_process
GO:0007610	behavior	IDA	biological_process
GO:0008009	chemokine activity	IDA	molecular_function
GO:0008009	chemokine activity	IDA	molecular_function
GO:0008360	regulation of cell shape	IDA	biological_process
GO:0009636	response to toxic substan ce	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010818	T cell chemotaxis	IDA	biological_process
GO:0014808	release of sequestered ca lcium ion into cytosol by sarcoplasmic reticulum	IDA	biological_process
GO:0016004	phospholipase activator a ctivity	IDA	molecular_function
GO:0016301	kinase activity	IDA	molecular_function
GO:0019722	calcium-mediated signalin g	IDA	biological_process
GO:0019722	calcium-mediated signalin g	IDA	biological_process
GO:0023052	signaling	IEP	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030502	negative regulation of bo ne mineralization	IDA	biological_process
GO:0030593	neutrophil chemotaxis	IDA	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IDA	biological_process
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031730	CCR5 chemokine receptor b inding	IPI	molecular_function
GO:0031730	CCR5 chemokine receptor b inding	IPI	molecular_function
GO:0032760	positive regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043308	eosinophil degranulation	IDA	biological_process
GO:0043491	protein kinase B signalin g	IMP	biological_process
GO:0043525	positive regulation of ne uron apoptotic process	ISS	biological_process
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0043615	astrocyte cell migration	ISS	biological_process
GO:0043922	negative regulation by ho st of viral transcription	IDA	biological_process
GO:0045671	negative regulation of os teoclast differentiation	IDA	biological_process
GO:0048245	eosinophil chemotaxis	IDA	biological_process
GO:0048246	macrophage chemotaxis	ISS	biological_process
GO:0048247	lymphocyte chemotaxis	IDA	biological_process
GO:0050718	positive regulation of in terleukin-1 beta secretio n	ISS	biological_process
GO:0050729	positive regulation of in flammatory response	ISS	biological_process
GO:0050729	positive regulation of in flammatory response	IBA	biological_process
GO:0050850	positive regulation of ca lcium-mediated signaling	IMP	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IEP	biological_process
GO:0051928	positive regulation of ca lcium ion transport	IDA	biological_process
GO:0051928	positive regulation of ca lcium ion transport	IDA	biological_process
GO:0051930	regulation of sensory per ception of pain	IDA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070723	response to cholesterol	IDA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IEP	biological_process
GO:0071347	cellular response to inte rleukin-1	IEP	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IEP	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IDA	biological_process
GO:0071621	granulocyte chemotaxis	IDA	biological_process
GO:0090280	positive regulation of ca lcium ion import	TAS	biological_process
GO:2000503	positive regulation of na tural killer cell chemota xis	IDA	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa05142  Chagas disease
hsa05323  Rheumatoid arthritis
hsa04620  Toll-like receptor signaling pathway
hsa05132  Salmonella infection

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 18242850
Endometriosis	PMID: 20617440
Polycystic ovary syndrome (PCOS)	PMID: 22007253
Sarcoidosis	PMID: 12413001
Endometriosis	INFBASE20617440

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
20617440	Endometrio sis			20 (12 with end ometriosis(ePF) , 8 controls wi thout endometri osis (cPF))		MIP-1?	Show abstract