Endometriosis Knowledgebase

Search Result

Gene id

6360

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CCL16 Gene UCSC Ensembl

Aliases

CKb12, HCC-4, ILINCK, LCC-1, LEC, LMC, Mtn-1, NCC-4, NCC4, SCYA16, SCYL4

Gene name

C-C motif chemokine ligand 16

Alternate names

C-C motif chemokine 16, IL-10-inducible chemokine, chemokine (C-C motif) ligand 16, chemokine LEC, liver CC chemokine-1, liver-expressed chemokine, lymphocyte and monocyte chemoattractant, monotactin-1, new CC chemokine 4, small inducible cytokine subfamily A (Cys,

Gene location

17q12 (35983619: 35976492) Exons: 5 NC_000017.11

Gene summary(Entrez)

This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10. [provided by RefSeq, Jul 2008]

OMIM

601394

Protein Summary

Protein general information

O15467

Name: C C motif chemokine 16 (Chemokine CC 4) (HCC 4) (Chemokine LEC) (IL 10 inducible chemokine) (LCC 1) (Liver expressed chemokine) (Lymphocyte and monocyte chemoattractant) (LMC) (Monotactin 1) (MTN 1) (NCC 4) (Small inducible cytokine A16)

Length: 120 Mass: 13,600

Tissue specificity: Mainly expressed in liver, also found in spleen and thymus. Highly expressed in LPS- and IFN-gamma-activated monocytes, weakly in some lymphocytes, including natural killer cells, gamma-delta T-cells, and some T-cell clones.

Sequence

MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREV
CTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Structural information

Interpro:	IPR000827 IPR001811
Prosite:	PS00472
Pfam:	PF00048
DIP:	5831
MINT:	140607
STRING:	ENSP00000293275;

Other Databases

GeneCards: CCL16; Malacards: CCL16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002548	monocyte chemotaxis	IBA	biological_process
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0007154	cell communication	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0048020	CCR chemokine receptor bi nding	IBA	molecular_function
GO:0048247	lymphocyte chemotaxis	IBA	biological_process
GO:0050729	positive regulation of in flammatory response	IBA	biological_process
GO:0050918	positive chemotaxis	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IBA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IBA	biological_process
GO:0071347	cellular response to inte rleukin-1	IBA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IBA	biological_process
GO:0002548	monocyte chemotaxis	IBA	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0007154	cell communication	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008009	chemokine activity	TAS	molecular_function
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0048020	CCR chemokine receptor bi nding	IBA	molecular_function
GO:0048247	lymphocyte chemotaxis	IBA	biological_process
GO:0050729	positive regulation of in flammatory response	IBA	biological_process
GO:0050918	positive chemotaxis	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IBA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IBA	biological_process
GO:0071347	cellular response to inte rleukin-1	IBA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IBA	biological_process
GO:0002548	monocyte chemotaxis	IBA	biological_process
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0007154	cell communication	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	TAS	molecular_function
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0048020	CCR chemokine receptor bi nding	IBA	molecular_function
GO:0048247	lymphocyte chemotaxis	IBA	biological_process
GO:0050729	positive regulation of in flammatory response	IBA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IBA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IBA	biological_process
GO:0071347	cellular response to inte rleukin-1	IBA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IBA	biological_process

KEGG pathways

hsa04060 Cytokine-cytokine receptor interaction
hsa04062 Chemokine signaling pathway

Diseases

Associated diseases	References
Endometriosis	PMID: 17506907
Endometriosis	INFBASE17506907

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17506907	Endometrio sis					CCL16 CCL21	Show abstract