Endometriosis Knowledgebase

Search Result

Gene id

6361

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CCL17 Gene UCSC Ensembl

Aliases

A-152E5.3, ABCD-2, SCYA17, TARC

Gene name

C-C motif chemokine ligand 17

Alternate names

C-C motif chemokine 17, CC chemokine TARC, T cell-directed CC chemokine, chemokine (C-C motif) ligand 17, small inducible cytokine subfamily A (Cys-Cys), member 17, small-inducible cytokine A17, thymus and activation-regulated chemokine,

Gene location

16q21 (57396075: 57416062) Exons: 6 NC_000016.10

Gene summary(Entrez)

This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. [provided by RefSeq, Sep 2014]

OMIM

601520

Protein Summary

Protein general information

Q92583

Name: C C motif chemokine 17 (CC chemokine TARC) (Small inducible cytokine A17) (Thymus and activation regulated chemokine)

Length: 94 Mass: 10,507

Tissue specificity: Expressed at high levels in thymus and at low levels in the lung, colon and small intestine.

Sequence

MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSD
PNNKRVKNAVKYLQSLERS

Structural information

Interpro:	IPR000827 IPR001811
Prosite:	PS00472
Pfam:	PF00048
PDB:	1NR2 1NR4
PDBsum:	1NR2 1NR4
DIP:	5842
MINT:	1525198
STRING:	ENSP00000219244;

Other Databases

GeneCards: CCL17; Malacards: CCL17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002548	monocyte chemotaxis	IBA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007275	multicellular organism de velopment	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0045662	negative regulation of my oblast differentiation	IEA	biological_process
GO:0048020	CCR chemokine receptor bi nding	IBA	molecular_function
GO:0048247	lymphocyte chemotaxis	IBA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IBA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IBA	biological_process
GO:0071347	cellular response to inte rleukin-1	IBA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IBA	biological_process
GO:0002548	monocyte chemotaxis	IBA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007275	multicellular organism de velopment	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008009	chemokine activity	TAS	molecular_function
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0045662	negative regulation of my oblast differentiation	IEA	biological_process
GO:0048020	CCR chemokine receptor bi nding	IBA	molecular_function
GO:0048247	lymphocyte chemotaxis	IBA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IBA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IBA	biological_process
GO:0071347	cellular response to inte rleukin-1	IBA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IBA	biological_process
GO:0002548	monocyte chemotaxis	IBA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007275	multicellular organism de velopment	TAS	biological_process
GO:0008009	chemokine activity	TAS	molecular_function
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0048020	CCR chemokine receptor bi nding	IBA	molecular_function
GO:0048247	lymphocyte chemotaxis	IBA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IBA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IBA	biological_process
GO:0071347	cellular response to inte rleukin-1	IBA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IBA	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway

Diseases

Associated diseases	References
Dermatitis	PMID: 15500644
Endometriosis	PMID: 23517860
Systemic lupus erythematosus	PMID: 14677179
Endometriosis	INFBASE23517860

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23517860	Endometrio sis			64 (22 bowel en dometriosis, 10 retrocervical endometriosis, 32 endometriosi s-free women)		CXCL9 CXCL10 CXCL11 CXCL12 XCL1 CCL17 CCL21and CX3CL1	Show abstract