Endometriosis Knowledgebase

Search Result

Gene id

6367

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CCL22 Gene UCSC Ensembl

Aliases

A-152E5.1, ABCD-1, DC/B-CK, MDC, SCYA22, STCP-1

Gene name

C-C motif chemokine ligand 22

Alternate names

C-C motif chemokine 22, CC chemokine STCP-1, MDC(1-69), chemokine (C-C motif) ligand 22, macrophage-derived chemokine, small inducible cytokine A22, small inducible cytokine subfamily A (Cys-Cys), member 22, stimulated T cell chemotactic protein 1,

Gene location

16q21 (57357908: 57366189) Exons: 4 NC_000016.10

Gene summary(Entrez)

This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, dendritic cells, natural killer cells and for chronically activated T lymphocytes. It also displays a mild activity for primary activated T lymphocytes and has no chemoattractant activity for neutrophils, eosinophils and resting T lymphocytes. The product of this gene binds to chemokine receptor CCR4. This chemokine may play a role in the trafficking of activated T lymphocytes to inflammatory sites and other aspects of activated T lymphocyte physiology. [provided by RefSeq, Sep 2014]

OMIM

602957

Protein Summary

Protein general information

O00626

Name: C C motif chemokine 22 (CC chemokine STCP 1) (MDC(1 69)) (Macrophage derived chemokine) (Small inducible cytokine A22) (Stimulated T cell chemotactic protein 1) [Cleaved into: MDC(3 69); MDC(5 69); MDC(7 69)]

Length: 93 Mass: 10,625

Tissue specificity: Highly expressed in macrophage and in monocyte-derived dendritic cells, and thymus. Also found in lymph node, appendix, activated monocytes, resting and activated macrophages. Lower expression in lung and spleen. Very weak expression i

Sequence

MDRLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEI
CADPRVPWVKMILNKLSQ

Structural information

Interpro:	IPR030598 IPR000827 IPR001811
Prosite:	PS00472
Pfam:	PF00048
DIP:	5849
MINT:	8091023
STRING:	ENSP00000219235;

Other Databases

GeneCards: CCL22; Malacards: CCL22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002548	monocyte chemotaxis	IBA	biological_process
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0009615	response to virus	TAS	biological_process
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0048020	CCR chemokine receptor bi nding	IBA	molecular_function
GO:0048247	lymphocyte chemotaxis	IBA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IBA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IBA	biological_process
GO:0071347	cellular response to inte rleukin-1	IBA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IBA	biological_process
GO:0002548	monocyte chemotaxis	IBA	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008009	chemokine activity	TAS	molecular_function
GO:0009615	response to virus	TAS	biological_process
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0048020	CCR chemokine receptor bi nding	IBA	molecular_function
GO:0048247	lymphocyte chemotaxis	IBA	biological_process
GO:0060326	cell chemotaxis	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IBA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IBA	biological_process
GO:0071347	cellular response to inte rleukin-1	IBA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IBA	biological_process
GO:0002548	monocyte chemotaxis	IBA	biological_process
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	TAS	molecular_function
GO:0009615	response to virus	TAS	biological_process
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0048020	CCR chemokine receptor bi nding	IBA	molecular_function
GO:0048247	lymphocyte chemotaxis	IBA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IBA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IBA	biological_process
GO:0071347	cellular response to inte rleukin-1	IBA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IBA	biological_process

KEGG pathways

hsa04060 Cytokine-cytokine receptor interaction
hsa04062 Chemokine signaling pathway

Diseases

Associated diseases	References
Endometriosis	PMID: 27128987
Multiple sclerosis	PMID: 17967467
Endometriosis	INFBASE27128987

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
27128987	Endometrio sis			94 (74 endometr iosis patients (stages I-II: 4 0; stages III-I V: 34) , 20 wom en without endo metriosis)	Female infertility		Show abstract